Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011648892.1 RL_RS33425 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000009265.1:WP_011648892.1 Length = 239 Score = 174 bits (440), Expect = 2e-48 Identities = 99/237 (41%), Positives = 142/237 (59%), Gaps = 3/237 (1%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 LL+ G+ YG+ +AL GVD+ V GE +++IGANGAGK+TLM +I G S+++ Sbjct: 3 LLETRGLTASYGDFQALFGVDIMVGSGETIAIIGANGAGKTTLMRSISGVLANAPASILY 62 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLF 130 I +P +I IA PEGR++FP + V ENL +G +E IF LF Sbjct: 63 RDEPIGALPAPDILARGIAMVPEGRKLFPSLNVEENLLVG-NYGRKIDGPWTLESIFALF 121 Query: 131 PRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLN 190 P LKER LSGG+QQM++IGR LM+ P LLL DE SLGLAP++V+ I+ A + Sbjct: 122 PILKERRNNPATALSGGQQQMVAIGRGLMSNPALLLCDEISLGLAPVVVRDIYGAFPLIR 181 Query: 191 EAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEGGRH 247 E G ++ +VEQ+ AL+++ R Y M+ G+VT+SG + L+ ++ AY H Sbjct: 182 ET-GASIVIVEQDIAQALKVADRVYCMMEGRVTLSGRTAD-LSRADIHKAYFGTDHH 236 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 239 Length adjustment: 23 Effective length of query: 224 Effective length of database: 216 Effective search space: 48384 Effective search space used: 48384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory