Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_011648892.1 RL_RS33425 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000009265.1:WP_011648892.1 Length = 239 Score = 190 bits (482), Expect = 2e-53 Identities = 98/235 (41%), Positives = 155/235 (65%), Gaps = 3/235 (1%) Query: 1 MSVLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKI 60 M++L+ L+ YG QA+ V V GE +++IGANGAGKTT++R++SG++ + I Sbjct: 1 MALLETRGLTASYGDFQALFGVDIMVGSGETIAIIGANGAGKTTLMRSISGVLANAPASI 60 Query: 61 EFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVF 120 + + I +PA I+A G++ VPEGR +FP L V ENL +G + +K + L+ +F Sbjct: 61 LYRDEPIGALPAPDILARGIAMVPEGRKLFPSLNVEENLLVGNYGRKI--DGPWTLESIF 118 Query: 121 SRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQ 180 + FP L+ER+N A LSGG+QQM+A+GR LMS P LLL DE S+GLAP+ +++I+ Sbjct: 119 ALFPILKERRNNPATALSGGQQQMVAIGRGLMSNPALLLCDEISLGLAPVVVRDIYGAFP 178 Query: 181 DIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 I++ G +++++EQ+ +AL ++DR Y + G++ LSG +L S ++ KAY G Sbjct: 179 LIRETGASIVIVEQDIAQALKVADRVYCMMEGRVTLSGRTADL-SRADIHKAYFG 232 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 239 Length adjustment: 23 Effective length of query: 213 Effective length of database: 216 Effective search space: 46008 Effective search space used: 46008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory