Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate WP_011648978.1 RL_RS33885 ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >NCBI__GCF_000009265.1:WP_011648978.1 Length = 342 Score = 200 bits (508), Expect = 5e-56 Identities = 115/312 (36%), Positives = 180/312 (57%), Gaps = 3/312 (0%) Query: 46 LARNPEWFTVALIVVTCLIVGAINPRFFQFATLFDLLHSATTMSLFALGTLVVLASGGID 105 L+ E+ A+I+ +++ RFF FDLL+ + +FA+G LVVL SGGID Sbjct: 6 LSHTTEFVLFAVIIAMSIVLAFATDRFFTLGNGFDLLNISAVNIIFAVGLLVVLISGGID 65 Query: 106 VSFTAIAALTMYGITKAVFAWWPDAPFALILVTGALGGVVLGMVNGLLVHRLKAPSLIVT 165 +SF A++ Y A+ + +L+ G +G +VLG++N L+HR + S++ T Sbjct: 66 ISFAVAASIVQYVTALALERIGGGGWLSGLLIAGGIG-IVLGVINAFLIHRFRIISIVAT 124 Query: 166 IGTQYLYRGLLLTFIGTTFFMNIPHSMDRFGRIPLFFYHTADGLRAVLPVSVLALVAAAV 225 I T +Y GLL+ F ++P + R+ ++ ADG A + + V+ +V + Sbjct: 125 IATFNVYFGLLMFFTKGVSIYDLPDWLT--SRVIIYEREMADGSWAEITLPVVVMVVCTL 182 Query: 226 VTWWLLNRTMMGRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGMLAGIAGILHVSNNRL 285 TW + RT GR +YA G + A R G N+ A+ FG+ G++AGIAG++ + Sbjct: 183 ATWLFITRTTTGRQLYAFGDNPEGARRFGINIGAMQFIAFGWLGLMAGIAGLMQAHYAQE 242 Query: 286 ANPFDLVGSELDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIKSVLILVGVPSTWQKV 345 P L G ELDV+AAV+LGGAR+ GG G+V+G +LGV+LV++ ++ L L+GV K+ Sbjct: 243 VVPNALYGRELDVLAAVVLGGARLGGGKGSVLGCVLGVLLVSITQNGLNLMGVSPFAFKM 302 Query: 346 IIGAFILLAGTL 357 I+GA IL+A TL Sbjct: 303 IVGAIILVAITL 314 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 342 Length adjustment: 29 Effective length of query: 335 Effective length of database: 313 Effective search space: 104855 Effective search space used: 104855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory