Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_011649024.1 RL_RS34160 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_000009265.1:WP_011649024.1 Length = 356 Score = 347 bits (891), Expect = e-100 Identities = 187/361 (51%), Positives = 251/361 (69%), Gaps = 10/361 (2%) Query: 1 MSALEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDI 60 M+++ + N RK YG E L G+DI ++ GEF++L+G SGCGKSTLL +IAGL E S G I Sbjct: 1 MASVSVANARKSYGHFEVLHGVDIDIQDGEFVILVGPSGCGKSTLLRMIAGLEEISAGRI 60 Query: 61 LIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARL 120 IG + V V PK+RDIAMVFQSYALYP+L+V N+GF L++ + P+ + + VR+ A + Sbjct: 61 SIGSKVVNNVAPKERDIAMVFQSYALYPHLTVEANMGFSLKLAKAPKEQTRQRVREAAEI 120 Query: 121 LQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLH 180 L + +LLDR P LSGGQRQRVA+GRA+VRNPQVFLFDEPLSNLDAKLR++MR+E+K+LH Sbjct: 121 LGLGHLLDRYPKNLSGGQRQRVAMGRAIVRNPQVFLFDEPLSNLDAKLRVQMRSEIKQLH 180 Query: 181 QMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMN 240 Q L+TT +YVTHDQIEAMT+A RI VMRDG +EQ+ +P ++YDRPA L+VAGF+GSP MN Sbjct: 181 QRLKTTTIYVTHDQIEAMTMADRIVVMRDGFVEQIGSPLDLYDRPANLFVAGFIGSPAMN 240 Query: 241 ILDAEMTANG---LKIEGCEEVLPLPAAFNGAAWAGRRVKVGIRPEALRLAAGSEAQRLT 297 ++ +++ +G L +G LPLP A G ++ GIRPE L + G A Sbjct: 241 LIRGQVSTSGPLELIADGGGR-LPLPEA--APLERGAQLIYGIRPEHLVIGHGPVA---- 293 Query: 298 ASVEVVELTGPELVTTATVGSQRITACLPPRTAVGMGSAHAFTFDGTALHLFDPESGRSL 357 A V +VE TG E+ T G+ ++ A + R + G T D + LHLFD ++ + Sbjct: 294 AEVVLVEPTGAEIQVTTKFGADQLVATVRERLDLRAGDQIVITPDLSKLHLFDAKTEKRF 353 Query: 358 R 358 R Sbjct: 354 R 354 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 356 Length adjustment: 29 Effective length of query: 331 Effective length of database: 327 Effective search space: 108237 Effective search space used: 108237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory