Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_011649371.1 RL_RS35975 aspartate aminotransferase family protein
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000009265.1:WP_011649371.1 Length = 458 Score = 172 bits (435), Expect = 3e-47 Identities = 126/417 (30%), Positives = 199/417 (47%), Gaps = 31/417 (7%) Query: 39 VIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFF--- 95 V+ +G V D G D +G+ +N G+ H +VEA +Q + + T +F Sbjct: 31 VLASAKGATVTDASGKQLIDGFAGLWCVNAGYGHESIVEAAARQMRELPY--ATAYFGLG 88 Query: 96 YENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKY------GTGRKQFLAFYH 149 E AI LA +L + APGD+ V + G++A ++ ++ ++Y R QF++ Sbjct: 89 SEPAIRLAGELADRAPGDLNH-VYFTLGGSDAVDSTIRFIRYYWHARGRPERDQFISVEQ 147 Query: 150 AFHGRTQAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLD 209 +HG + LTA GF IP YRN G + P+ + N L Sbjct: 148 GYHGSSTVGAGLTALPAFHA-GFGVPFDWQHKIPSHYAYRNPVG----DNPEAIINASLA 202 Query: 210 FIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGI 269 ++ V + P + A + EPIQG GG +VPPKG+ KA+++F + IL DEV G Sbjct: 203 ALKSKV-EAIGPERVAAFYVEPIQGSGGVLVPPKGWMKAMREFCRSHDILFVADEVITGF 261 Query: 270 GRTGKFWAIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADITFDKPGR--------HATTF 321 GRTG +A V PD + K + G G + AD ++ H T+ Sbjct: 262 GRTGPLFACTEDEVVPDFMTTAKGLTSGYVPMGAVLMADHVYETIAEGAGAAAVGHGYTY 321 Query: 322 GGNPVAIAAGIEVVEIVKE-LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEI 380 +PV+ A G+EV+++ + LL + G L + L+ ++ + ++GD RG G+ AVE+ Sbjct: 322 SAHPVSAAVGLEVLKLYENGLLENGLRAGARLMQGLDSLRD-HPLVGDVRGRGMLAAVEL 380 Query: 381 VKSKETKEKYP---ELRDRIVKESAKRGLVLLGCGDNSIRFIPPLIVTKEEIDVAME 434 V K K P E RI + + GLV+ G+ + + PPL T+ EID +E Sbjct: 381 VVDKVNKTPLPASAEPARRIFDRAWENGLVIRAFGNGVLGYAPPLCCTETEIDAIVE 437 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 458 Length adjustment: 33 Effective length of query: 412 Effective length of database: 425 Effective search space: 175100 Effective search space used: 175100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory