Align Trehalose/maltose transport system permease protein MalG (characterized)
to candidate WP_011649435.1 RL_RS36320 carbohydrate ABC transporter permease
Query= SwissProt::Q7LYX6 (278 letters) >NCBI__GCF_000009265.1:WP_011649435.1 Length = 294 Score = 170 bits (431), Expect = 3e-47 Identities = 97/276 (35%), Positives = 157/276 (56%), Gaps = 6/276 (2%) Query: 2 REEVLKRILLIIGAI---LMAIICLFPFIWMIVVSFAEDPTFLGSPLVEYKSTLENYVRV 58 R +L+R+ + L+A++ LFPF WM+ + + + P+ + V Sbjct: 17 RHRILRRVGTFVSYAALSLIALLFLFPFFWMVSNAVRSNAEVMAVPVRIFPEEYHWGTFV 76 Query: 59 LSDPTLHFPAYLKNSIIIASLVTLTTVSISSLAAYAVSRIEFKGRLLIPIFVLGLSMFPQ 118 + +L F +L NS ++A VT +++S L+AYA +R+ F GR + + L M PQ Sbjct: 77 EALVSLPFGTFLLNSFVVACGVTAIVIAVSCLSAYAFARLRFPGREGLLLTYLSTLMIPQ 136 Query: 119 ISLVGYLFKFIEKLGWVNTYQALYFPYVAWTLPLSLWILLSYFSQLPKDLDEAAMIDGAS 178 + LV LF + K GW+NTY + P VA++ ++L + +PKDLDEAAM+DGAS Sbjct: 137 VMLVIPLFLIVSKFGWINTYHGMILP-VAFS-SFGTFLLRQFILGIPKDLDEAAMMDGAS 194 Query: 179 RIKTLTTIILPLSAPALFSTALLVFIAAFNEFMFALLFTTDHRARTVPVGIALFQGVHGE 238 R++ L T+I+PL+ PA+ AL FIA + F++ L+ T+ T+P+G+ LFQ G Sbjct: 195 RLRILVTVIVPLAMPAIGLLALFTFIAQWKSFLWPLIATSGVEMATLPLGLTLFQTQQG- 253 Query: 239 IPWGSVMAASVISTIPLVIMALLFQKYIVSGLTAGA 274 W +MA + IS +P VI+A++ Q+ I G+T + Sbjct: 254 TAWNYIMAGATISMVPGVILAIVLQRVIYKGITVSS 289 Lambda K H 0.329 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 294 Length adjustment: 26 Effective length of query: 252 Effective length of database: 268 Effective search space: 67536 Effective search space used: 67536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory