Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_011649653.1 RL_RS26490 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000009265.1:WP_011649653.1 Length = 365 Score = 332 bits (851), Expect = 1e-95 Identities = 186/368 (50%), Positives = 235/368 (63%), Gaps = 8/368 (2%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 MA + L GV K+YG V V+ +I+L I GE +VFVGPSGCGKSTLLRMIAG E ITGG + Sbjct: 1 MAGVTLAGVSKSYGTVNVIRDISLSINDGEFLVFVGPSGCGKSTLLRMIAGFETITGGDV 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 + G VND+ RG+AMVFQ+YALYPHMT RENM+F L+ +AEI ++ AA Sbjct: 61 LLGGNRVNDMAARDRGVAMVFQNYALYPHMTARENMAFGLRNIGTPKAEIALRIDKAAAI 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 LQL YLDR PKALSGGQRQRVAIGR+I+R+P V+LFDEPLSNLDAALRV+ R EIA+L Sbjct: 121 LQLEPYLDRKPKALSGGQRQRVAIGRAIMREPDVFLFDEPLSNLDAALRVSMRTEIAKLH 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 + +TM+YVTHDQ EAMT+A RIVVL G I QVG+P+ELYE+P N FVA F+G+P++ Sbjct: 181 HRL-AATMIYVTHDQTEAMTMADRIVVLRDGQIEQVGAPIELYERPANAFVAGFLGAPRI 239 Query: 241 NLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYVFE 300 NLLP + +T G ++ G V +G+RPE ++ A G Sbjct: 240 NLLPATVTAVDGETVELACAGDARLTAKVRASPAKGDTVTIGLRPEILLPADEG---ALS 296 Query: 301 GKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHVF---KDG 357 G V + E LG + L+Y G + + +G G V R P HVF K Sbjct: 297 GTVDVVEQLGSLQLVYATLADG-TAIVSEQRGGAAPSIGSVARFAIGPGTRHVFDANKVS 355 Query: 358 VSLHYPHG 365 ++LH G Sbjct: 356 ITLHSEAG 363 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 365 Length adjustment: 30 Effective length of query: 343 Effective length of database: 335 Effective search space: 114905 Effective search space used: 114905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory