Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate WP_011650217.1 RL_RS02225 ribokinase
Query= reanno::Smeli:SMc01103 (299 letters) >NCBI__GCF_000009265.1:WP_011650217.1 Length = 299 Score = 402 bits (1032), Expect = e-117 Identities = 211/299 (70%), Positives = 242/299 (80%) Query: 1 MITVFGSINMDLIATTARLPKPGETVAGTDFSTAAGGKGANQALAARRAGASVRMAGAVG 60 MITVFGSINMDLIATT RLPKPGETVAG F+TAAGGKGANQALAARRAG V MAGAVG Sbjct: 1 MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALAARRAGRYVHMAGAVG 60 Query: 61 SDAFAEGALALLKEAGTDLDLTKTVGEPTGTAHIIVGGDGENVIVVVASANARVSGDDAA 120 DAFA ALALL +AGTDL L K V PTGTA I+VGGDGEN+I VV AN +V+ DA Sbjct: 61 KDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMIAVVPGANGQVTPADAE 120 Query: 121 NVVAQMSAGDTLMLQLEIPSASVEKALSEAKRRGIRSIINIAPLTPDAARLGRMADIVIA 180 + +M+ GD LMLQLE+P A+VE+ALS A+ +G+ SI+N+APL PDA RLGR+ADIVIA Sbjct: 121 TAIGRMNEGDILMLQLEVPVAAVERALSAARAKGVTSILNLAPLIPDAPRLGRLADIVIA 180 Query: 181 NETEFELLAGKAGIAGAEREEAMNGLHAETRQTVIVTLGAEGVVAIHEGELHRAKGLTIE 240 NETEFE LAG+ G+ RE A+ LHAET QT+IVTLGA+GV+AI +G + RA+GL IE Sbjct: 181 NETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADGVIAIRDGAISRAQGLKIE 240 Query: 241 PVDTVGAGDTFCGYLAAGLDAGLAFSEALRRAAIAGSLACLKPGAQPSIPLAAEVAARL 299 PVDTVGAGDTFCGY AA LD GL F ALRRAA+AGSLACL+ GAQPSIPL+ EVA R+ Sbjct: 241 PVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACLEAGAQPSIPLSEEVADRI 299 Lambda K H 0.315 0.131 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 299 Length adjustment: 27 Effective length of query: 272 Effective length of database: 272 Effective search space: 73984 Effective search space used: 73984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory