Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate WP_011650420.1 RL_RS03385 sugar kinase
Query= SwissProt::A2WXV8 (323 letters) >NCBI__GCF_000009265.1:WP_011650420.1 Length = 325 Score = 139 bits (349), Expect = 1e-37 Identities = 102/312 (32%), Positives = 155/312 (49%), Gaps = 15/312 (4%) Query: 9 VSFGEMLIDFVPTVAGVSLAEAPAFVKA-PGGAPANVAIAVARLGGGAAFVGKLGDDEFG 67 V GE+L++ V T G EA V GAPA RLGG AA VG +GDD+FG Sbjct: 14 VCVGEILVEIVATTVGDGFLEAQPLVGPFASGAPAIFISQCGRLGGKAAMVGAVGDDDFG 73 Query: 68 RMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADGEREFMFYRNPSADMLLTHAELNVE 127 R+ L+ +GVD + D T AFV R DG R+F++ SA ++ + Sbjct: 74 RVNTDRLKRDGVDVSTISIDPDYPTGSAFVRYRKDGSRDFVYNIATSAAARFGWSQTVGD 133 Query: 128 LIKRAAVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNLREALWPSREEARTKIL 187 LI R+ H +L R+ +A+ I K G LS DPN+R+ L ++ R + Sbjct: 134 LINRSGHLHVMGSALSVPSARAVIDKAVGIVKARGGTLSVDPNIRKELKLDKDTER-RFS 192 Query: 188 SIWDHADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYYARD-FRG 246 + AD++ S ELE G++ + + + +L+ +K +++ G +G Y+ RD R Sbjct: 193 KLVAAADLLLPSGEELERAAGVEG-KAEAIRRLFEVGVKEIVLKRGAEGATYFGRDGDRI 251 Query: 247 AVPSYKVQQVDTTGAGDAFVGALL--RRIVQDPSSLQDQKKLEEAIKFANACGAITATKK 304 P++ VQ+VD TGAGD F GA L RR+ P ++A+ + +A GA T Sbjct: 252 DAPAFVVQEVDPTGAGDCFGGAYLTCRRLGMSP---------QQALTYGSAAGARNVTVL 302 Query: 305 GAIPSLPTEVEV 316 G + T+ E+ Sbjct: 303 GPMEGAGTQQEL 314 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 325 Length adjustment: 28 Effective length of query: 295 Effective length of database: 297 Effective search space: 87615 Effective search space used: 87615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory