Align Maleylacetoacetate isomerase; MAAI; EC 5.2.1.2 (uncharacterized)
to candidate WP_011651126.1 RL_RS07405 glutathione S-transferase
Query= curated2:Q9X4F7 (213 letters) >NCBI__GCF_000009265.1:WP_011651126.1 Length = 203 Score = 76.3 bits (186), Expect = 4e-19 Identities = 62/183 (33%), Positives = 84/183 (45%), Gaps = 10/183 (5%) Query: 7 LYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAKAHRAPEHLARNPQGLVPVLDIDGERL 66 LY + S ++R + L+L G Y V VDL A AH+AP+ L NP G VPVLD +G + Sbjct: 3 LYHHPLSGHAHRAHLFLSLLGVPYELVEVDLAAGAHKAPDFLKLNPFGQVPVLDDNGTVI 62 Query: 67 TQSLAIIEYLAETRDGTGLLPAHPIDRQRVRA-LSYAVAMDIHPVCNLGVVARVMAGAGD 125 S AI+ YLA T LP + R++ LS A + C +V A Sbjct: 63 ADSSAILVYLARKYGRTDWLPEEAVAAARIQKWLSVASGEIAYGPCAARLVTVFGADFRA 122 Query: 126 GEAARREWMQKFIGEGLAAFERMLDHPATGAFCHGDRPTMADLCLVPQVYNARRWDVDLA 185 E R LA E L +F GD P +AD+ L + NA +VD++ Sbjct: 123 DEVIAR------AHRILALIEAELQ---GRSFLLGDNPVIADVALYSYIANAPEGNVDIS 173 Query: 186 ACP 188 A P Sbjct: 174 AYP 176 Lambda K H 0.324 0.138 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 203 Length adjustment: 21 Effective length of query: 192 Effective length of database: 182 Effective search space: 34944 Effective search space used: 34944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory