Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_011651405.1 RL_RS09080 sugar ABC transporter permease
Query= uniprot:D8J112 (347 letters) >NCBI__GCF_000009265.1:WP_011651405.1 Length = 334 Score = 226 bits (575), Expect = 8e-64 Identities = 125/308 (40%), Positives = 186/308 (60%), Gaps = 16/308 (5%) Query: 40 FASLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMM-- 97 F + LL+++ SF++ F+ N+ ++L T++NGVLAI T+VI+T GIDLSVG+++ Sbjct: 28 FLAFLLLVVVLSFSNEFFLTGGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVGSVVAL 87 Query: 98 ------TFCAVMAGVVLTNWGMPLPLGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGM 151 +F A + P+ +G+A I G G ISG ++++ VP F+ATLGM Sbjct: 88 AGIVSASFSTTSATAAIAGAPYPVAIGLAVGILVGVACGAISGAIVSRFSVPAFVATLGM 147 Query: 152 MMLLKGLSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASII 211 + +GL+L+ G RP+ T F I + G IP V+IL +V + I Sbjct: 148 LSAARGLTLIYGGGRPVPAL-TPAFRWIGTGDVFG-------IPAPVIILAVVFAASWWI 199 Query: 212 LNKTVFGRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPAL 271 L++T FGRY +A+G N A + SG+ + + VY SG + G+AG+++++R SA P Sbjct: 200 LSRTRFGRYIYAVGGNPHAAKTSGIDIGRIRFTVYVISGGLAGLAGMLLSARTGSALPQA 259 Query: 272 GQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVI 331 G YELDAIAAVVIGGTSLSGG G + GT+IGA I+ V+ NGL +M + +Q V+ G + Sbjct: 260 GIAYELDAIAAVVIGGTSLSGGVGRVTGTLIGALIIGVMNNGLDLMGIQSYYQQVLKGAL 319 Query: 332 IILAVYLD 339 I+ AV LD Sbjct: 320 IVGAVMLD 327 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 334 Length adjustment: 28 Effective length of query: 319 Effective length of database: 306 Effective search space: 97614 Effective search space used: 97614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory