Align Methylglutaconyl-CoA hydratase, mitochondrial; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding enoyl-CoA hydratase; muAUH; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 (characterized)
to candidate WP_011651446.1 RL_RS09490 enoyl-CoA hydratase/isomerase family protein
Query= SwissProt::Q9JLZ3 (314 letters) >NCBI__GCF_000009265.1:WP_011651446.1 Length = 259 Score = 136 bits (342), Expect = 6e-37 Identities = 90/252 (35%), Positives = 127/252 (50%), Gaps = 8/252 (3%) Query: 64 IVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAK 123 + L I+R NAL ++LK L+ A D ++++ VR I+ E G F AG D+K Sbjct: 14 VATLTISRPEKLNALDLDMLKALADAADQVEANANVRAAILTGEGKG-FSAGGDIKAWGG 72 Query: 124 MHSSEVGP-FVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGL 182 M E G +V + +A L +P IAA++G ALGGGLELA DIR+A K+GL Sbjct: 73 MLPQEFGHLWVRHGHRIFERLATLRMPLIAALNGHALGGGLELAGVADIRLAEQHIKIGL 132 Query: 183 VETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAA 242 ET L ++PG GTQRL R G + + + +EA+ +G++ V+ A Sbjct: 133 PETGLGMVPGWSGTQRLVRRFGAQAVRRMALGGEIFTAEEARLLGIVDAVVPTGN----A 188 Query: 243 YRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLA 302 A + A +GP A +AKL I D G A+E T D EG+ + Sbjct: 189 LTAAREYAGRIAARGPAATEIAKLMIASANGED--NGTAVEALGSILAAKTGDLKEGVAS 246 Query: 303 FKEKRPPRYKGE 314 F EKRP +KGE Sbjct: 247 FSEKRPATFKGE 258 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 259 Length adjustment: 26 Effective length of query: 288 Effective length of database: 233 Effective search space: 67104 Effective search space used: 67104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory