Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate WP_011651485.1 RL_RS09700 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2935 (358 letters) >NCBI__GCF_000009265.1:WP_011651485.1 Length = 369 Score = 371 bits (953), Expect = e-107 Identities = 184/354 (51%), Positives = 243/354 (68%), Gaps = 5/354 (1%) Query: 6 ENPMGLMGFEFIELASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILNNEPHS 65 +NP G GFEF+E A P P TL +F MG+ VA H++KD+ ++RQG IN +LN EP S Sbjct: 16 DNPAGTDGFEFVEFAHPEPETLRELFTRMGYVAVARHKTKDITVWRQGDINYVLNAEPGS 75 Query: 66 VASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPIHIETGPMELNLPAIKGIGGAPL 125 A+ F A HGP MA+RV D+Q A+K A+ GA P E L++PAI GIGG+ L Sbjct: 76 HAARFVASHGPCAPSMAWRVVDAQHAFKHAVSKGAVPY--EGDDKALDVPAIVGIGGSLL 133 Query: 126 YLIDRFGEGSSIYDIDFVFIEGVDRHPVGAGLKIIDHLTHNVYRGRMAYWANFYEKLFNF 185 Y ++ +G S YD +F ++ D HP G G +DHLTHNV+RG M W +FY LFNF Sbjct: 134 YFVETYGARGSAYDAEFDWLGESDPHPQGIGFYYLDHLTHNVFRGNMDKWWDFYRNLFNF 193 Query: 186 REIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQHVAFL 245 ++I +FDI G TGL S+A+T+P G IRIPLN ES QIEE+L ++ GEGIQH+A Sbjct: 194 KQIHFFDIDGRITGLVSRAITSPCGKIRIPLN-ESKDDTSQIEEYLKKYKGEGIQHIAVG 252 Query: 246 SDDLIKTWDHLKSIGMRFMTAPPETYYEMLEGRLPNHGEPVDQLQARGILLDGSS--ESG 303 ++D+ D L G+RFM PPETYY+M R+ H EPV++++ GIL+DG G Sbjct: 253 TEDIYDATDRLADNGLRFMPGPPETYYDMSYERVNGHSEPVERMKKHGILIDGEGVVNGG 312 Query: 304 DKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLST 357 ++LLQIFS+T++GP+FFEFIQRKGD+GFGEGNF+ALFESIE DQ++RGV+ T Sbjct: 313 MTKILLQIFSKTVIGPIFFEFIQRKGDEGFGEGNFRALFESIEADQIKRGVIGT 366 Lambda K H 0.321 0.141 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 369 Length adjustment: 29 Effective length of query: 329 Effective length of database: 340 Effective search space: 111860 Effective search space used: 111860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011651485.1 RL_RS09700 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.8029.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-127 411.2 0.0 2.7e-127 411.0 0.0 1.0 1 lcl|NCBI__GCF_000009265.1:WP_011651485.1 RL_RS09700 4-hydroxyphenylpyruva Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_011651485.1 RL_RS09700 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.0 0.0 2.7e-127 2.7e-127 2 352 .. 23 363 .. 22 364 .. 0.97 Alignments for each domain: == domain 1 score: 411.0 bits; conditional E-value: 2.7e-127 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakHG 70 gf+fvefa+++++ ++++l++++G+ ava+ +++k++tv+rqg+i++vl+ae+ s+ aa+f+a+HG lcl|NCBI__GCF_000009265.1:WP_011651485.1 23 GFEFVEFAHPEPE-TLRELFTRMGYVAVAR---HKTKDITVWRQGDINYVLNAEPGSH--AARFVASHG 85 8***********9.***************8...*************************..********* PP TIGR01263 71 dgvkdvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekgsilpgfe 139 +++ ++a++v d+++af++av++ga +++ +k+++++ai giG+++l++ve++g +gs +++++ lcl|NCBI__GCF_000009265.1:WP_011651485.1 86 PCAPSMAWRVVDAQHAFKHAVSKGAVPYEGD----DKALDVPAIVGIGGSLLYFVETYGARGSAYDAEF 150 ***************************8776....479******************************* PP TIGR01263 140 evsekaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvlasae 208 ++ + + +++++g++++DH+++nv rg+++k+++fy+++++fk+i+ fdi++++++L+S++++s++ lcl|NCBI__GCF_000009265.1:WP_011651485.1 151 DWLGE--SDPHPQGIGFYYLDHLTHNVFRGNMDKWWDFYRNLFNFKQIHFFDIDGRITGLVSRAITSPC 217 ****7..566679******************************************************** PP TIGR01263 209 gkvklplnepaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflk.ipetYYdnlke 276 gk+++plne sk+++sQIeeyl++y+G+G+QH+A+ tedi++++++l ++g++f++ +petYYd+ e lcl|NCBI__GCF_000009265.1:WP_011651485.1 218 GKIRIPLNE--SKDDTSQIEEYLKKYKGEGIQHIAVGTEDIYDATDRLADNGLRFMPgPPETYYDMSYE 284 *********..9********************************************************* PP TIGR01263 277 rvkklvkedleelkelkiLvDrd...eeG...lLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaL 339 rv+ ++e++e++k+++iL+D++ + G +LLQiF+k+v+ g++FfE+IqRkg++GFGegNf+aL lcl|NCBI__GCF_000009265.1:WP_011651485.1 285 RVNG-HSEPVERMKKHGILIDGEgvvNGGmtkILLQIFSKTVI--GPIFFEFIQRKGDEGFGEGNFRAL 350 ***7.******************9966669999**********..************************ PP TIGR01263 340 feaiEreqekrgv 352 fe+iE +q+krgv lcl|NCBI__GCF_000009265.1:WP_011651485.1 351 FESIEADQIKRGV 363 ***********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (369 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.07 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory