Align Threonine dehydratase 2 biosynthetic, chloroplastic; SlTD2; Threonine deaminase 2; EC 4.3.1.17; EC 4.3.1.19 (characterized)
to candidate WP_011651573.1 RL_RS10150 threonine ammonia-lyase
Query= SwissProt::P25306 (595 letters) >NCBI__GCF_000009265.1:WP_011651573.1 Length = 416 Score = 204 bits (518), Expect = 8e-57 Identities = 126/395 (31%), Positives = 205/395 (51%), Gaps = 10/395 (2%) Query: 113 SPLELAEKLSDRLGVNFYIKREDKQRVFSFKLRGAYNMMSN-LSREELDKGVITASAGNH 171 +PL+L + LS R G + ++KRED V S+K+RGA+N + + K + ASAGNH Sbjct: 20 TPLQLNDHLSARYGADIWLKREDLSPVRSYKIRGAFNFFRKAIGQGAAGKTFVCASAGNH 79 Query: 172 AQGVALAGQRLNCVAKIVMPTTTPQIKIDAVRALGGDVV---LYGKTFDEAQTHALELSE 228 AQG A + + MP TTPQ KID R G + + L+G FD+ A E E Sbjct: 80 AQGFAFVCRHFGVPGVVFMPVTTPQQKIDKTRMFGAEFITIRLFGDFFDQCYQAAREHVE 139 Query: 229 KDGLKYIPPFDDPGVIKGQGTIGTEINRQLKD---IHAVFIPVGGGGLIAGVATFFKQIA 285 G +PPFD +I+GQ T+ EI +QL + V +PVGGGGL AG+ ++ Sbjct: 140 AIGGVMVPPFDHADIIEGQATVAAEIMQQLPEGTVPDMVVLPVGGGGLAAGITSYLDGTV 199 Query: 286 PNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVGEYTFAKCQEL-IDGMV 344 P + + EP GA S+ S+ G L+ VD F DG AVA +G+ FA ++ + + Sbjct: 200 PKSAFVFTEPAGAPSLKRSIEAGKVTTLAKVDNFVDGAAVARIGDLNFAALRDFPAEQVQ 259 Query: 345 LVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNENIVAIASGANMDFSK 404 L+ + I I+++ + +LE +GA+++ AA + I+ + IVA+ SG N DF + Sbjct: 260 LIPENAICVTIQEMLNVEGVVLEPAGALSLTAIAA-MDGQAIRGKTIVAVVSGGNFDFER 318 Query: 405 LHKVTELAGLGSGKEALLATFMVEQQGSFKTFVGLVG-SLNFTELTYRFTSERKNALILY 463 L V E A +G + + ++ G+ + F+ L+G + Y S R IL Sbjct: 319 LPDVKERAMRYAGLKKYFILRLAQRPGALRDFLNLLGPDDDIARFEYLKKSARNFGSILI 378 Query: 464 RVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVD 498 + + ++I + +++ M +++ NE++ + Sbjct: 379 GIETKAPENFARLIGNFEAAGMGYEDITENEILAN 413 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 595 Length of database: 416 Length adjustment: 34 Effective length of query: 561 Effective length of database: 382 Effective search space: 214302 Effective search space used: 214302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory