Align deoxyribose kinase (EC 2.7.1.15) (characterized)
to candidate WP_011652279.1 RL_RS14180 ribokinase
Query= reanno::Burk376:H281DRAFT_01116 (320 letters) >NCBI__GCF_000009265.1:WP_011652279.1 Length = 310 Score = 349 bits (895), Expect = e-101 Identities = 177/302 (58%), Positives = 216/302 (71%) Query: 11 VVILGIYVTDLTFRAARMPLVGETIAGSAFAMGPGGKGSNQAVAAARAGAEVVFCTRIGN 70 V ILGI+V D + A RMP VGETI G+ FA+GPGGKGSNQAVAAARAG V F ++IG Sbjct: 5 VSILGIFVADTAYLAKRMPNVGETITGTGFAVGPGGKGSNQAVAAARAGGTVSFISKIGR 64 Query: 71 DAFGSIAQATWAREGITARASVVEGVSTGAAHIFVDDTTGMNAIIVAAGAAGTLSAADVD 130 D FG +A T+A G+T + ++ + TGAA I+V+D G NAIIV GAAGT+ DV+ Sbjct: 65 DTFGDMALKTYAEAGVTPKVVQMDDMPTGAAFIYVNDGNGDNAIIVYPGAAGTIGIGDVE 124 Query: 131 AIEADIAGSRVFVTQLEQPLAAARRGLEVARKHGVTTVFNPAPALPLDDDIFPLCDYITP 190 A I S VFVTQLEQP AA+R LE+A GVTTVFNPAPA P D I+PLCDYI P Sbjct: 125 AARETIEQSAVFVTQLEQPAEAAQRALEIAHAAGVTTVFNPAPAEPFPDTIYPLCDYIVP 184 Query: 191 NETEAAALTGVPIANVDDARRAADVLLAKGVGTVIVTLGEGGALLHDATQSIWLPAFRCG 250 NETEAAA+ G P+ +DDARRA D LLAKGV ++TLG G L H A QS+ +PA G Sbjct: 185 NETEAAAIVGFPLDTLDDARRAGDALLAKGVKAALITLGGRGVLYHTARQSVHVPAVSSG 244 Query: 251 AVVETAGAGDGFTGGFAAALARGEDAISAMRFGCALAGISVTRAGTAPSMPTLAEVNRVL 310 AV++T GAGD F GGF+AAL+RG + A+RFGCA AGI+VTR GTAP+MP + E+ +L Sbjct: 245 AVIDTTGAGDAFVGGFSAALSRGASPVEAVRFGCATAGIAVTRRGTAPAMPKIEEIEALL 304 Query: 311 SE 312 + Sbjct: 305 QK 306 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 310 Length adjustment: 27 Effective length of query: 293 Effective length of database: 283 Effective search space: 82919 Effective search space used: 82919 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_011652279.1 RL_RS14180 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.14599.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-97 310.1 3.8 8.9e-97 310.0 3.8 1.0 1 lcl|NCBI__GCF_000009265.1:WP_011652279.1 RL_RS14180 ribokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_011652279.1 RL_RS14180 ribokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.0 3.8 8.9e-97 8.9e-97 1 297 [. 5 301 .. 5 302 .. 0.97 Alignments for each domain: == domain 1 score: 310.0 bits; conditional E-value: 8.9e-97 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgeelle 69 + ++G + +D+ +kr+p+ Get++++ f +++GGKG+NQAvaaar g +vs+i+k+G+D+fg+++l+ lcl|NCBI__GCF_000009265.1:WP_011652279.1 5 VSILGIFVADTAYLAKRMPNVGETITGTGFAVGPGGKGSNQAVAAARAGGTVSFISKIGRDTFGDMALK 73 6799***************************************************************** PP TIGR02152 70 nlkkegidteyvkkvkktstGvAlilvde.egeNsIvvvaGaneeltpedvkaaeekikesdlvllQlE 137 ++++ g++ + v+ +++++tG A+i v++ +g+N+I+v+ Ga ++ dv+aa+e+i++s + + QlE lcl|NCBI__GCF_000009265.1:WP_011652279.1 74 TYAEAGVTPKVVQ-MDDMPTGAAFIYVNDgNGDNAIIVYPGAAGTIGIGDVEAARETIEQSAVFVTQLE 141 *******666555.789**********98689************************************* PP TIGR02152 138 ipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaekaaek 206 p e++++al+ia++agv++++nPAPae+ +++++ l+d+ivpNetEa++++g ++l+da++a ++ lcl|NCBI__GCF_000009265.1:WP_011652279.1 142 QPAEAAQRALEIAHAAGVTTVFNPAPAEP-FPDTIYPLCDYIVPNETEAAAIVGFPLDTLDDARRAGDA 209 ***************************76.99************************************* PP TIGR02152 207 llekgvkaviitlGskGallvskdekklipalkvka.vDttaAGDtFigalavaLaegksledavrfan 274 ll+kgvka +itlG +G+l++++ ++ ++pa+ a +Dtt+AGD+F+g++++aL++g s +avrf+ lcl|NCBI__GCF_000009265.1:WP_011652279.1 210 LLAKGVKAALITLGGRGVLYHTARQSVHVPAVSSGAvIDTTGAGDAFVGGFSAALSRGASPVEAVRFGC 278 *******************************9876527******************************* PP TIGR02152 275 aaaalsVtrkGaqssiPtkeeve 297 a a ++Vtr G+++++P+ ee+e lcl|NCBI__GCF_000009265.1:WP_011652279.1 279 ATAGIAVTRRGTAPAMPKIEEIE 301 *********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.46 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory