Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_011652367.1 RL_RS14685 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000009265.1:WP_011652367.1 Length = 248 Score = 194 bits (494), Expect = 1e-54 Identities = 106/251 (42%), Positives = 155/251 (61%), Gaps = 6/251 (2%) Query: 2 ALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVT 61 ++L V+ ++K FGG+ AV DV+ E+ +GE++GLIGPNG+GK+TLFN + G P G V Sbjct: 4 SVLSVRNISKTFGGIQAVKDVSFEVMKGEVLGLIGPNGSGKSTLFNCVLGQLRPDRGEVF 63 Query: 62 LDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAF 121 ++GH + G +A G+GRTFQ + +F D+TVLDN+++A ++H T RL F Sbjct: 64 VNGHAVAGMKACDLAKRGVGRTFQQLSVFPDMTVLDNIILA----GQEHQGTMLSRL--F 117 Query: 122 YKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAG 181 K + L +A +L+ F L E A LSYGQQ+ L+ A P ++ LDEPA G Sbjct: 118 GKPDAGLTQQAEQLVDFFKLRHLKEDKAGALSYGQQKLLDAAMAFMAGPDLVLLDEPAGG 177 Query: 182 MNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKT 241 +N L E ++ + T ++IEH+M VM + RI VL G +IA+G PDEI+ Sbjct: 178 VNLTMLGNLKERLQTYNRDHDTTFVVIEHNMEFVMSLCTRIIVLAEGAIIAEGAPDEIRA 237 Query: 242 NKRVIEAYLGG 252 N++VI+AYLGG Sbjct: 238 NQQVIDAYLGG 248 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory