Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate WP_011652438.1 RL_RS15090 FAD-dependent oxidoreductase
Query= reanno::azobra:AZOBR_RS08020 (436 letters) >NCBI__GCF_000009265.1:WP_011652438.1 Length = 403 Score = 196 bits (499), Expect = 8e-55 Identities = 140/407 (34%), Positives = 199/407 (48%), Gaps = 20/407 (4%) Query: 2 RVIVLGSGVIGVSTAYFLAKAGHEVTVVDRQPGPALETSYANAGEVSPGYSAPWAAPGLM 61 RV V+G+GVIGVS+AY LA+AGH+VT++D P + S NA ++S Y A+P L+ Sbjct: 3 RVAVIGAGVIGVSSAYLLARAGHDVTLIDAASEPGMGASAGNAAQLSWAYGDAMASPALL 62 Query: 62 AKAVKWMLMKHSPLVIRPKMDPAMWSWCLKLLANANERSYEINKGRMVRLAEYSRDCLRV 121 + + IR ++D W LK LAN S+ N ++RLAE SR L + Sbjct: 63 KHLPAIAMGRDPAFRIRWQLDRDFLCWGLKFLANTPFSSWWNNTQEILRLAEQSRHELVI 122 Query: 122 LRDETGIRYDERAKGTLQVFRTQKQVDAAATDMAVLDRFKVPYSLLDVEGCAAVEPALRL 181 L ET I +D R G L ++ ++ AA + +A + LL VEPAL Sbjct: 123 LLKETDIEFDYRVAGKLHLYADRQSFAAADSSVARKNALGFEQRLLTRVEAEDVEPALAA 182 Query: 182 VKEKIVGGLLLPGDETGDCFRFTNALAA-MATELGVEFRYNTGIRKLESDGRRVTGV-VT 239 + +I G + P D GD F L A M V + + G +TG+ Sbjct: 183 YQGEIAGAVYTPSDALGDAAGFCRQLTAWMIERRQVSVLFGRKVSTFVQTGSVLTGLRFE 242 Query: 240 DAGTLTADSYVVAMGSYSPTLVKPFGLDLP----VYPVKGYSLTLPIVDAAGAPESTVMD 295 D L D+ +VA G V+ F DLP + P++GYSLT + AP ++ D Sbjct: 243 DRDELRVDAAIVAAGPE----VRSFISDLPEARDIRPIRGYSLT--VRRTGLAPSISLTD 296 Query: 296 ETHKIAVTRLGDRIRVGGTAEL----TGFDLTLRPGRRGPLDHVVSDLFPTGGDLSKAEF 351 K+A +GDR RV G A++ GFD R V+ DLF +L + Sbjct: 297 VKRKLAFAAIGDRFRVAGLADIERPGAGFDAGRFETLRLAASAVLPDLFERSDELMR--- 353 Query: 352 WTGLRPNTPDGTPIVGPT-PVRNLFLNTGHGTLGWTMAAGSGRVVAD 397 W+G RP TP PI+ + ++ L++N GHG LGWT+A GS R V D Sbjct: 354 WSGERPMTPTSMPIIAASRRIKGLYINAGHGMLGWTLALGSARRVVD 400 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 403 Length adjustment: 32 Effective length of query: 404 Effective length of database: 371 Effective search space: 149884 Effective search space used: 149884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory