Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate WP_011653502.1 RL_RS21115 N-formylglutamate amidohydrolase
Query= reanno::Phaeo:GFF3578 (261 letters) >NCBI__GCF_000009265.1:WP_011653502.1 Length = 293 Score = 103 bits (256), Expect = 5e-27 Identities = 74/237 (31%), Positives = 107/237 (45%), Gaps = 20/237 (8%) Query: 10 PLVLGLPHTGTDVPPEVWACLNETGRALADTDWHIHDLYAG--LAEGITTVRTPVHRYVI 67 P V PH+G PPE A G A+ ++ H D G +A G + R + Sbjct: 21 PFVYNSPHSGRIYPPEFIAQSRLEGIAIRRSEDHYVDELFGSAVALGAPLLAANFPRAYL 80 Query: 68 DVNRDPGGIS-------LYPGQNTTTL--------VPLTDFDGLPIWQEGKEPNEAEITR 112 DVNR+P + L P N +L +P + + I+ E Sbjct: 81 DVNREPYELDPRMFDGLLPPYANVNSLRVAGGLGTIPRIVAENMEIYARRLPVQEG--LD 138 Query: 113 RRDAYHAPYHAALMAELERVKAIHGFAILYDCHSIRGDIPFLFEGRLPDFNTGTNMGTTC 172 R +A + PYHAAL + R GF +L DCHS+ G++ PDF G GT+ Sbjct: 139 RVEAVYKPYHAALRRLIARTHVQFGFGVLIDCHSMPGNVRVAGSTARPDFIIGDRYGTSA 198 Query: 173 DPEIEALTVAHCEAAEGYTSTLNGRFKGGWTTRHYGRPADGLHAIQMELAQATYCQE 229 E+ +A E G+ + N + GG+ T HYGRP+ GLHA+Q+E+ +A Y E Sbjct: 199 SAELSRAAIAILEEM-GFAAIRNKPYAGGFITEHYGRPSRGLHALQIEVNRAIYVDE 254 Lambda K H 0.319 0.137 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 293 Length adjustment: 25 Effective length of query: 236 Effective length of database: 268 Effective search space: 63248 Effective search space used: 63248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory