Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_011653742.1 RL_RS22490 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_000009265.1:WP_011653742.1 Length = 426 Score = 407 bits (1046), Expect = e-118 Identities = 199/424 (46%), Positives = 293/424 (69%) Query: 1 MEAFILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPF 60 ME +IL G F L+LIG P+A+ LG+++ ++ +P + ++ SG++ FSLLAIPF Sbjct: 1 MELWILFGVFTTLMLIGTPIAFCLGVASFATVLYMGLPPLVIFQRLNSGMSVFSLLAIPF 60 Query: 61 FVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSV 120 F+ AG +M GG++ R+VAFA LVG VRGGL VNI+ +T FG ISGS+VA+ A+VG + Sbjct: 61 FIYAGDLMVRGGIASRIVAFAASLVGHVRGGLGQVNIVTATLFGGISGSAVAEAAAVGGL 120 Query: 121 LIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGL 180 +IP+M+++GY +++ VT ++ ALL PPSHN ++YS++AGG +SIA LF AG++PGL Sbjct: 121 MIPQMKQRGYGADYAVNVTSMAALIALLLPPSHNMIIYSISAGGKISIADLFTAGVLPGL 180 Query: 181 LLSAVMMGLCLIFAKKRNYPKGEVIPLREALKIAGEALWGLMAMVIILGGILSGVFTATE 240 LL+ +M I A+ R YP + AL GL+ + II GG+ SGVFTATE Sbjct: 181 LLAVALMVTAYIVARSRGYPTEPFPGFVMVAHLLAVALPGLLLIAIIFGGVRSGVFTATE 240 Query: 241 SAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPS 300 S+ +AV+++ +T+ +YR WRD VRT ++V+++IG AA+F ++M +++P+ Sbjct: 241 SSCIAVLYALLITLLVYRQMSWRDFVHATQGAVRTTAMVLLIIGTAAAFSWLMAFLKVPA 300 Query: 301 KITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGM 360 + +++D+ +L+ +N ++++LGT MDM P I+I TPI LPV GVDPVHFG+ Sbjct: 301 SLVIWMKSVADDPLTVLLLLNVLMLVLGTFMDMGPTIIICTPIFLPVAQAYGVDPVHFGV 360 Query: 361 IMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLW 420 IM++N GIGL TPPVGAV FV A+GK+S+ ++++ PFY A +VL VTYIPAISLW Sbjct: 361 IMILNFGIGLNTPPVGAVQFVACAVGKISVWEAMRSIWPFYGAGIVVLGLVTYIPAISLW 420 Query: 421 LPSV 424 LPSV Sbjct: 421 LPSV 424 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory