Align L-2-keto-3-deoxyarabonate dehydratase (EC 4.2.1.43) (characterized)
to candidate WP_011653849.1 RL_RS23110 4-hydroxy-tetrahydrodipicolinate synthase
Query= reanno::HerbieS:HSERO_RS06870 (306 letters) >NCBI__GCF_000009265.1:WP_011653849.1 Length = 296 Score = 121 bits (304), Expect = 2e-32 Identities = 90/293 (30%), Positives = 146/293 (49%), Gaps = 16/293 (5%) Query: 6 YRGVFPVAPTIFDANGKLDLEGQKRAIDFMIDAGSNGLCILANFSEQFVLSDEERVQVQN 65 +RGV+ V T D +G +DL+G D+ + G +GL L + E LS+EER V Sbjct: 5 FRGVYTVMITPLDPSGAVDLKGLAAFTDWQVKEGIHGLIPLGSTGEFLSLSEEERDSVAR 64 Query: 66 TVLEHVAGRVPVIVTTTHYGSQICAERSRAAQDAGAAMVMVMPPYHGATFRVPEKQIYEF 125 TV+E VAGRVPV++ T ++ S A+ GA VM++PP++ + ++ Sbjct: 65 TVIETVAGRVPVLIGTGAEDTRESIRLSVKAEAMGADGVMIIPPFYSTP---TDDELVHH 121 Query: 126 YKHVSDAIDIPIMIQDAPVAGTPLSAPFLARMAKEIEQVSYFKIETAGAASKLRDLIELG 185 YK ++ A+ IPIM+ + P P L + EI+ Y K E+ +++RD+I L Sbjct: 122 YKSIASAVTIPIMVYNNPATANVDLTPELVKRIAEIDGCDYIK-ESTLEVTRVRDIIRLA 180 Query: 186 GD--AVVGPWDGEEAITLIPDLDAGATG--AMTGGGYPDGIRKIVDAYF-AGDIEKAAEL 240 GD V G G E+ + GA G A+ P + +I + ++A EL Sbjct: 181 GDDMTVFGGILGFESFVM------GAQGWVAVASNVAPGPMARIFELVANEKKFDEAREL 234 Query: 241 YMQWLPLINYENRQCGLSACKALMLEGGVIKSDMLRHPQPPLHPKVREGLLRV 293 Y++WLP+I Q ++ K+L+ G + + R P+ PL P+ + R+ Sbjct: 235 YLKWLPVIQAVGGQAYVAGTKSLLTHMG-FGAGLPRPPRLPLPPEQDAAMKRL 286 Lambda K H 0.321 0.138 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 296 Length adjustment: 27 Effective length of query: 279 Effective length of database: 269 Effective search space: 75051 Effective search space used: 75051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory