Align Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 (characterized)
to candidate WP_011653972.1 RL_RS23820 glutathione S-transferase family protein
Query= SwissProt::P57113 (216 letters) >NCBI__GCF_000009265.1:WP_011653972.1 Length = 215 Score = 61.2 bits (147), Expect = 1e-14 Identities = 62/210 (29%), Positives = 98/210 (46%), Gaps = 28/210 (13%) Query: 5 KPVLYSYFRSSCSWRVR--IALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPAL 62 +P LY ++ SW R +AL G+D+E V I GG + + + ++P +VP L Sbjct: 3 RPTLYIANKNYSSWSFRPWMALTGAGVDFEEVLIPFDYPGG---NPDIKAISPTGRVPLL 59 Query: 63 KIDGITIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQV 122 K + I +SLAI+EY+ E P LLP+D RA+ R +S + S + L++ + Sbjct: 60 KHGVLKIWESLAIIEYVAELYPDAGLLPRDRAGRALARSVSMEMLSSFRALRSACPM--- 116 Query: 123 GQENQMPWAQKAITSGFNA--------LEKILQSTAGKYCVGDEVSMADVCLAPQVANAE 174 + P + A+ G +A +LQ + G + G S AD AP V Sbjct: 117 --NIRRPKGRIALPDGVDADIGRIETIWHDLLQQSGGPFLFG-AFSGADGMFAPVV---N 170 Query: 175 RFKVDLSPYPTISHINKALLALEAFQVSHP 204 RF + Y +S N L +E + +HP Sbjct: 171 RFDI----YDLVSR-NDTLAYMETMK-AHP 194 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 215 Length adjustment: 22 Effective length of query: 194 Effective length of database: 193 Effective search space: 37442 Effective search space used: 37442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory