Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_011654485.1 RL_RS29725 sugar ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_000009265.1:WP_011654485.1 Length = 273 Score = 194 bits (493), Expect = 2e-54 Identities = 109/249 (43%), Positives = 159/249 (63%), Gaps = 10/249 (4%) Query: 2 AQEPILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEG 61 +++P+L+ RG+ K +G V+AL + D++ GE++A++GDNGAGKS+++K ++G P G Sbjct: 11 SRQPVLSLRGISKNFGAVSALTDIELDVHAGEVVALVGDNGAGKSTLVKILAGVHQPSSG 70 Query: 62 EIRLEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSL 121 I EGKP+ SP A GI TV+Q+LAL L + N+FLG+E+ L Sbjct: 71 TILFEGKPVNLPSPSAALGLGIATVFQDLALCENLDVVANIFLGKELSP--------YQL 122 Query: 122 DRAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAA 181 D AME +A L+EL I ++ + V +LSGGQRQ VA+AR+ K++++DEPTAA Sbjct: 123 DEVAMEIRAWQLLNELS-ARIPSVREPVASLSGGQRQTVAIARSLLLEPKLIMLDEPTAA 181 Query: 182 LGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMS 241 LGV ++ VL+LI VR RGL +++ISHNM V VADRI + RLGR + P D + Sbjct: 182 LGVAQTAEVLDLIERVRERGLAVIMISHNMEDVRAVADRIVVLRLGRNNGTMLP-DASNE 240 Query: 242 DAVAFMTGA 250 V+ +TGA Sbjct: 241 QLVSAITGA 249 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 273 Length adjustment: 25 Effective length of query: 235 Effective length of database: 248 Effective search space: 58280 Effective search space used: 58280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory