Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate WP_011654955.1 RL_RS30800 N-formylglutamate deformylase
Query= reanno::Smeli:SM_b21164 (271 letters) >NCBI__GCF_000009265.1:WP_011654955.1 Length = 273 Score = 423 bits (1087), Expect = e-123 Identities = 201/262 (76%), Positives = 221/262 (84%) Query: 5 EVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPDATAVRATF 64 E+R+G+SP+ILGFPHTGT+VP I +RLNDNGR+LADTDWHIH LY GLL + T VRATF Sbjct: 12 EIRRGTSPIILGFPHTGTEVPPEIADRLNDNGRMLADTDWHIHQLYDGLLDNVTTVRATF 71 Query: 65 HRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFHAPYH 124 HRYVIDANRDPAGVSLYPGQNTTGLVP+TDFDG IWKEG P + DI RLRDFHAPYH Sbjct: 72 HRYVIDANRDPAGVSLYPGQNTTGLVPQTDFDGKAIWKEGAAPNDADIAARLRDFHAPYH 131 Query: 125 AALSAEIARVKAIHGVVVLYDCHSIRSHIPFLFEGRLPDFNIGTDMGKTCATEIERAAAE 184 AAL+AEI RV+AIHGV +LYDCHSIRSHIPFLFEG+LPDFNIGTDMGKTC + IE+A Sbjct: 132 AALAAEIERVRAIHGVAILYDCHSIRSHIPFLFEGKLPDFNIGTDMGKTCDSAIEQATLT 191 Query: 185 IAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMELAQSTHLATEAPPFALDRAKAD 244 + A+ Y +LNGRFKGGWTTRHYGRPE GVHAIQMELAQSTHL TEA PFA D AKAD Sbjct: 192 VVEAAKGYDGVLNGRFKGGWTTRHYGRPETGVHAIQMELAQSTHLQTEAAPFAYDAAKAD 251 Query: 245 RLRRPLKAILERIETVAKELKR 266 RLR LK IL RIE +A LKR Sbjct: 252 RLRVHLKNILVRIEQIAPGLKR 273 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 273 Length adjustment: 25 Effective length of query: 246 Effective length of database: 248 Effective search space: 61008 Effective search space used: 61008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_011654955.1 RL_RS30800 (N-formylglutamate deformylase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.3364.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-123 396.6 0.0 2.9e-123 396.4 0.0 1.0 1 lcl|NCBI__GCF_000009265.1:WP_011654955.1 RL_RS30800 N-formylglutamate def Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_011654955.1 RL_RS30800 N-formylglutamate deformylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.4 0.0 2.9e-123 2.9e-123 3 261 .. 11 268 .. 9 270 .. 0.99 Alignments for each domain: == domain 1 score: 396.4 bits; conditional E-value: 2.9e-123 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidv 71 e++rG++P+++++PhtGt++++++++rl+++ ++l+dtdWhi++lyd++ d t+vra+++r+vid+ lcl|NCBI__GCF_000009265.1:WP_011654955.1 11 CEIRRGTSPIILGFPHTGTEVPPEIADRLNDNGRMLADTDWHIHQLYDGLLDN-VTTVRATFHRYVIDA 78 5799************************************************9.99************* PP TIGR02017 72 nrdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgk 140 nrdp+g+slypgq+ttgl+P+t+fdg++++k+G aP++a+i+ rl ++ Pyhaal+aeier+ra+hg+ lcl|NCBI__GCF_000009265.1:WP_011654955.1 79 NRDPAGVSLYPGQNTTGLVPQTDFDGKAIWKEGAAPNDADIAARLRDFHAPYHAALAAEIERVRAIHGV 147 ********************************************************************* PP TIGR02017 141 ivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrhy 209 ++lyd+hsirs+iP+lfeGklPdfn+Gt++gk+cd a+++a v++ akg+ vlnGrfkGG++trhy lcl|NCBI__GCF_000009265.1:WP_011654955.1 148 AILYDCHSIRSHIPFLFEGKLPDFNIGTDMGKTCDSAIEQATLTVVEAAKGYDGVLNGRFKGGWTTRHY 216 ********************************************************************* PP TIGR02017 210 gqPqngvhavqlelaqrgyleeetePvaydeakaealravlkellealldfa 261 g+P++gvha+q+elaq+++l+ e+ P+ayd+aka+ lr++lk++l +++++a lcl|NCBI__GCF_000009265.1:WP_011654955.1 217 GRPETGVHAIQMELAQSTHLQTEAAPFAYDAAKADRLRVHLKNILVRIEQIA 268 *********************************************9999887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (273 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.51 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory