Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_011763778.1 AZO_RS00205 short chain dehydrogenase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_000061505.1:WP_011763778.1 Length = 253 Score = 119 bits (297), Expect = 8e-32 Identities = 81/251 (32%), Positives = 132/251 (52%), Gaps = 15/251 (5%) Query: 15 VFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAGIA-----DVSKQ 69 V V+ +GIG A AE A V D+ +++ R L G A DV+K Sbjct: 10 VIVTGAGSGIGRAAAELMAREGAIVIASDLKLDTVEDTAHRIT-LAGGRAVAVRTDVAKL 68 Query: 70 AQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAV 129 A++D + D A + G LD NNAGI GP A+ + + A +++ ++ NL + +Y +++ + Sbjct: 69 AELDALHDLAIAEFGRLDGAFNNAGIPGPGVALADHEEAAFDALIAINLKAVWYGMKRQI 128 Query: 130 PVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILP 189 ++ A I+ +SV G +G P + Y +TK A++GL K+ A E G VRVNA+ P Sbjct: 129 ELMLPGGGGA-IVNTASVGGIVGKPGLSVYCATKHAVIGLTKTAALEYGSRGVRVNAVCP 187 Query: 190 GVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNV 249 GV+ +D+VI+ + A EE+ + + RM T +++A ++L SP S V Sbjct: 188 GVIRTPMVDQVIAGQPGA--------EEEWNRLQPIGRMGTPEELAETVVWLMSPRASLV 239 Query: 250 TGQAISVDGNV 260 G A+ DG + Sbjct: 240 HGHALVADGGL 250 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 253 Length adjustment: 24 Effective length of query: 239 Effective length of database: 229 Effective search space: 54731 Effective search space used: 54731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory