Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_011763977.1 AZO_RS01240 TRAP transporter large permease
Query= SwissProt::O07838 (440 letters) >NCBI__GCF_000061505.1:WP_011763977.1 Length = 427 Score = 288 bits (738), Expect = 2e-82 Identities = 159/443 (35%), Positives = 257/443 (58%), Gaps = 22/443 (4%) Query: 1 MSALIIFGLLIALMLTGMPISISLGLTVLTFL----FTMTQVPIDTVALKLFTGIEKFEI 56 M+ +++ GL + ++ G+P+++ LG+ + L F VP + ++ GI K+ + Sbjct: 1 MTGVVLIGLFLLALVAGLPLAVGLGVASIAVLALAGFDQLAVPTN-----IYAGIAKYPL 55 Query: 57 MAIPFFILAGNFLTHGGVAKRMINFATAMVGHWHGGLGLAGVIACALFAAVSGSSPATVV 116 +AIP FILAG GVA R++ F TAMVG W G L + V+ L +SGS PA Sbjct: 56 LAIPMFILAGMIFERSGVALRLVRFVTAMVGEWTGSLAVVAVLVSMLLGGISGSGPADAA 115 Query: 117 AIGSVILPAMVNQGFPKQFGAGVITTSGALGILIPPSIVMVMYAVATSGMVVTGPDGQPV 176 A+ +V+LP+MV +G+PK F AG+I +G+ I+IPPS+ ++Y+V V Sbjct: 116 AVAAVMLPSMVARGYPKGFSAGLIAAAGSTAIVIPPSVAFIVYSVM-------------V 162 Query: 177 SSASVGELFMAGVVPGLMLAGFLAFTTWNRARKFGYPRLEKASLRQRWTAFREAAWGLML 236 +A+V LF AG+ PG++ A L +RK+G+ R +A +F +A WGL+ Sbjct: 163 PAATVPALFAAGLFPGMIAALCLLIPAVLISRKYGFGRDYRAERPPLGKSFVDAIWGLLA 222 Query: 237 IVVVIGGIYAGIFTPTEAAAMSAVYAFFISVFVYKDLTLRDVPRVLLSSANMSAMLLYII 296 V+++GG+ AGIFTPTEAA ++ Y F+ + VY+ +T + + R+L+ + +SA+++ II Sbjct: 223 PVIILGGLRAGIFTPTEAAVVAVAYGIFVGMVVYRTITPKTLFRLLVDAGELSAVVMMII 282 Query: 297 TNAVLFSFLMAHEGIPQALGEWMVNAGLSWWMFLIIVNILLLAAGNFMEPSSIVLIMAPI 356 A +F++ GI A + +V W L+ VN+LLL AG F++ SI LI+ P+ Sbjct: 283 GVASVFAWAGNTLGIFDAAAKALVEMHPGHWGMLLSVNLLLLVAGMFLDAVSIFLILLPL 342 Query: 357 LFPVAVRLGIDPVHFGIMIVVNMEVGMCHPPVGLNLYVASGITKMGITELTVAVWPWLLT 416 L P+A+ +G D V FG+M+ +N+ +G PP+ L+L + S I +GI + V ++L Sbjct: 343 LVPIALAMGWDLVWFGVMMTINLAIGQFTPPMALSLMITSRIAGIGIEQTFRWVIWFVLA 402 Query: 417 MLAFLVLVTYVPAISLALPNLLG 439 M A L + P ++L LP LG Sbjct: 403 MGAGLAAMVVFPELALWLPRRLG 425 Lambda K H 0.329 0.142 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 606 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 440 Length of database: 427 Length adjustment: 32 Effective length of query: 408 Effective length of database: 395 Effective search space: 161160 Effective search space used: 161160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory