Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_011764035.1 AZO_RS01520 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_000061505.1:WP_011764035.1 Length = 267 Score = 136 bits (343), Expect = 4e-37 Identities = 86/263 (32%), Positives = 138/263 (52%), Gaps = 8/263 (3%) Query: 2 AYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDA---DDAIGAIVVTGSE 58 ++E I E V +TLNRP LN+ ND + E+ AL + A D ++ +V+ + Sbjct: 3 SFETIRYEVAAGVATLTLNRPDRLNSFNDQMHREVREALAQVQAGRADGSVRVLVIAAAG 62 Query: 59 KAFAAGADIGMMSTYTYMDVYK-GDYITRNWE----TVRSIRKPIIAAVAGFALGGGCEL 113 + F AG D+ + + G I +N++ T+R++ P+IAAV G A G G L Sbjct: 63 RGFCAGQDLSDRNVSAGAEAPDLGASIEKNYKPLVTTLRNLDLPVIAAVNGVAAGAGANL 122 Query: 114 AMMCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAER 173 A+ CD++FAA +A F Q KLG++P GG+ LPR + A+A+ L L + A +AE+ Sbjct: 123 ALACDLVFAARSASFIQSFAKLGLVPDTGGSWILPRLLGPARALGLALLGDKLPAEQAEQ 182 Query: 174 AGLVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHS 233 GL+ + + +L AAT+A P+ K+++ + + ER + Sbjct: 183 WGLIWKCVDDDALQATVQQVAATLANGPTFGYAQTKKAIWASTTNDFDTQLDLERDAMRA 242 Query: 234 LFATEDQKEGMAAFVEKRKPVFK 256 + D +EG+AAF+EKR P FK Sbjct: 243 CGRSHDYREGVAAFMEKRAPQFK 265 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 267 Length adjustment: 25 Effective length of query: 233 Effective length of database: 242 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory