Align ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (EC 1.14.13.149) (characterized)
to candidate WP_011764043.1 AZO_RS01560 phenylacetate-CoA oxygenase/reductase subunit PaaK
Query= metacyc::MONOMER-15950 (357 letters) >NCBI__GCF_000061505.1:WP_011764043.1 Length = 355 Score = 361 bits (926), Expect = e-104 Identities = 182/353 (51%), Positives = 240/353 (67%), Gaps = 3/353 (0%) Query: 3 KFHSLTIKEVRPETRDAVSIAFDVPAELADSFRFTQGQHLVMRTQLDGEEVRRSYSICTG 62 +FH L + EVR ET D+VS+ F+VPA+LA +RF QGQHL ++ ++GEEVRRSYSIC+G Sbjct: 4 RFHPLKVAEVRRETADSVSLRFEVPADLAADYRFVQGQHLNLKAVVNGEEVRRSYSICSG 63 Query: 63 VNDGELRVAIKRVAGGRFSAYANESLKAGQRLEVMPPSGHFHVELDAARHGNYLAVAAGS 122 V+DGELRVAI++V GGRFS++A ++++ G EVM P G F +LD A +Y+A AAGS Sbjct: 64 VDDGELRVAIRKVDGGRFSSWAVDAVRVGDVFEVMTPEGRFSTQLDPANAHHYVAFAAGS 123 Query: 123 GITPILSIIKTTLETEPHSRVTLLYGNRSSASTLFREQLEDLKNRYLQRLNLIFLFSREQ 182 GITPILS+IKTTL EP SR TL+YGNR+ S +F E LEDLK+RYL R L +FSRE+ Sbjct: 124 GITPILSLIKTTLRAEPKSRFTLVYGNRNQNSAMFAEALEDLKDRYLTRFALYNVFSREE 183 Query: 183 QDVDLYNGRIDADKCGQLFSRWIDVKALDAAFICGPQAMTETVRDQLKANGMAAERIHFE 242 Q+V L+NGR+D + I +DAAFICGP M + V LK G+ A+RIH E Sbjct: 184 QEVPLFNGRLDQARVAAFLDTLIPAADIDAAFICGPGGMIDEVEAALKGAGVPADRIHLE 243 Query: 243 LFAAAGSAQKREARESAAQDSSVSQITVISDGRELSFELPRNSQSILDAGNAQGAELPYS 302 F SA + A D+ ++ITVI DG + E SILD G +LPYS Sbjct: 244 RFGVPASAPRHHVE---AGDAPQARITVIVDGLKREMEFRAQDPSILDVALRAGLDLPYS 300 Query: 303 CKAGVCSTCKCKVVEGEVEMDSNFALEDYEVAAGYVLSCQTFPISDKVVLDFD 355 CK GVC TC+ KV+EG+V MD N+ LE ++ AGYVL+CQ P++++VV+ +D Sbjct: 301 CKGGVCCTCRAKVLEGKVRMDKNYTLEQPDIDAGYVLTCQAHPLTERVVISYD 353 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 355 Length adjustment: 29 Effective length of query: 328 Effective length of database: 326 Effective search space: 106928 Effective search space used: 106928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory