Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011764049.1 AZO_RS12610 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000061505.1:WP_011764049.1 Length = 253 Score = 188 bits (477), Expect = 1e-52 Identities = 112/249 (44%), Positives = 164/249 (65%), Gaps = 14/249 (5%) Query: 7 TGQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTG 66 T +L++ + YG + AL ++ V +G+IV++IG NGAGK+T++ I G ++ G Sbjct: 5 TKNKVLEIQDLCVAYGKVEALTNANLTVGEGQIVTVIGPNGAGKTTMLSAIMGVLNSK-G 63 Query: 67 SVVFEGRDITRMPTHEIARLRIAQS----PEGRRIFPRMTVLENLQMGAGLD---NLKHF 119 V F+G I +P E+ R+ +A+ PE R +F MTV +NL +GA + Sbjct: 64 KVAFDG-SIEAVP--EVERM-VARGMNLVPEKRELFGEMTVEDNLTLGAFQRYRMGKRDH 119 Query: 120 AEDVEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIV 179 + +E+++ LFPRLKER +Q GTLSGGE+QML++GRALMA+PKLL+LDEPSLGLAPLIV Sbjct: 120 GQTMEEVYHLFPRLKERRSQLAGTLSGGERQMLAVGRALMAKPKLLMLDEPSLGLAPLIV 179 Query: 180 KGIFEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRA 239 + IF I +L + G+++ LVEQNA AAL+++ AYV+ G++ M G +L +P V Sbjct: 180 REIFRIIAELRK-RGVSILLVEQNARAALQVADYAYVLETGQIAMEGPAAQLKDDPRVIE 238 Query: 240 AYLE-GGRH 247 AYL GG+H Sbjct: 239 AYLGLGGKH 247 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 253 Length adjustment: 24 Effective length of query: 223 Effective length of database: 229 Effective search space: 51067 Effective search space used: 51067 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory