Align BadK (characterized)
to candidate WP_011764415.1 AZO_RS03415 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000061505.1:WP_011764415.1 Length = 260 Score = 125 bits (313), Expect = 1e-33 Identities = 93/260 (35%), Positives = 125/260 (48%), Gaps = 11/260 (4%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAG-NTRAFAAG 64 IL + V ++L+ P LNA+N + L A AD G+ IV+ G AFAAG Sbjct: 5 ILVDRGDAVATVSLSNPGKLNAVNAGMWRQLRAAFAELGADPGVRCIVLRGAGDEAFAAG 64 Query: 65 ADIASM----AAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIV 120 DI A + Y + IR P +AA+ G GGG E+A CD+ Sbjct: 65 GDIEEFRTVRATVDDALHYHEELVAAALNAIRDCPVPTVAAIRGACVGGGLEIAGCCDLR 124 Query: 121 IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV 180 IAG S++F P KLG G L +G A +++ L R L+A EA + GL+SRV Sbjct: 125 IAGASSRFGAPINKLGFSMYPGEMAGLLALVGPAVVLEILLEGRILDAAEALQKGLLSRV 184 Query: 181 VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFE--STLAEGILFERRELHARFASA 238 VDD + DE A A IAA AP + + + + L+E ERR A+ Sbjct: 185 VDDANVFDEAAACAARIAA-GAPLVARWHKQWAKRLQRPEPLSEA---ERRAAFDFLATE 240 Query: 239 DAREGIQAFLEKRAPCFSHR 258 D REG++AFL KR P F R Sbjct: 241 DYREGLEAFLAKRKPVFKGR 260 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory