Align Putative L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE (characterized, see rationale)
to candidate WP_011764902.1 AZO_RS05935 (Fe-S)-binding protein
Query= uniprot:A0A0C4YIN5 (262 letters) >NCBI__GCF_000061505.1:WP_011764902.1 Length = 268 Score = 295 bits (754), Expect = 9e-85 Identities = 149/262 (56%), Positives = 179/262 (68%), Gaps = 11/262 (4%) Query: 4 RRYPPAPAQVYLFATCLVDMFVPQAGLDAVRLLEREGLTVHFPRGQSCCGQPAYSSGNPE 63 R YPP P VY + TCLVDMFVP+AG+DA+ LLEREG+ V FP Q+CCGQPA++SG P Sbjct: 11 RTYPPRPQAVYFYGTCLVDMFVPEAGMDAIALLEREGIRVIFPENQTCCGQPAFTSGFPG 70 Query: 64 QARAVALAQLDLFAEPWPVIVPSGSCAGMMRHHWPQLFAQDPVAGPKAALLAERVYELSE 123 +AR V +QLDLF +P++VPSGSC GM+R HW + DP KAA ++ER YE +E Sbjct: 71 EARQVVASQLDLFPGDYPIVVPSGSCGGMLRWHWEKAVGDDPALKAKAAAISERTYEFAE 130 Query: 124 FLLHVLKVRFDVSGVAGQPPETVVLHTSCAARREMGTRDHGVALVDALPGVTRTEHQRES 183 FLLHV+ G P TV LHTSC+ARREMGT G L+ L VT H ES Sbjct: 131 FLLHVVGFNRQDQG----PATTVTLHTSCSARREMGTHLVGRELLARLGNVTLAHHDHES 186 Query: 184 ECCGFGGTFSLKHPDISGAMVQDKIASACATGCDRLVSADCGCLLNI-GHAARHQ----- 237 ECCGFGGTFSLKHPD+S AMV DK+AS ATG ++V+ADCGC+LNI G AA+ Sbjct: 187 ECCGFGGTFSLKHPDVSTAMVSDKVASLKATGAAQMVTADCGCMLNITGRAAKEDQDAGR 246 Query: 238 -GAPLPVEHIASFLWRRTGGAA 258 LP EH+A+FL RRTGG A Sbjct: 247 AKPSLPGEHLATFLLRRTGGKA 268 Lambda K H 0.323 0.136 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 268 Length adjustment: 25 Effective length of query: 237 Effective length of database: 243 Effective search space: 57591 Effective search space used: 57591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory