Align Phosphoglucomutase/phosphomannomutase; PGM/PMM; EC 5.4.2.2; EC 5.4.2.8 (characterized)
to candidate WP_011765122.1 AZO_RS07025 phosphoglucosamine mutase
Query= SwissProt::Q68BJ6 (456 letters) >NCBI__GCF_000061505.1:WP_011765122.1 Length = 451 Score = 204 bits (520), Expect = 4e-57 Identities = 153/448 (34%), Positives = 220/448 (49%), Gaps = 32/448 (7%) Query: 3 KLFGTFGVRGIANE-EITPEFALKIGMAFG-TLLKRE---GRERPLVVVGRDTRVSGEML 57 K FGT GVRG E ITPEF +++G A G TL+ RE ERP +++G+DTRVSG ML Sbjct: 4 KYFGTDGVRGRVGELPITPEFVMRLGYAAGVTLVAREHLPAGERPAILIGKDTRVSGYML 63 Query: 58 KDALISGLLSTGCDVIDVGIAPTPAIQWATNHFNADGGAVITASHNPPEYNGIKLLEPNG 117 + AL +G + G DV+ G PTPA+ + T G VI+ASHNP NGIK G Sbjct: 64 EAALQAGFAAAGVDVLLAGPIPTPAVAYLTRALRLQAGVVISASHNPFYDNGIKFFSAGG 123 Query: 118 MGLKKEREAIVEELFFSEDFHRAKWNEIGELRK-EDIIKPYIEAIK----NRVDVEAIKK 172 L EA +EE + A+ +G R+ D YIE K N +D+ ++ Sbjct: 124 AKLPDAVEAEIEER-IGQPMGCAESARLGRARRIGDAAGRYIEFCKSSFPNELDLRGLR- 181 Query: 173 RRPFVVVDTSNGAGSLTLPYLLRELGCKVVSVNAHPDG-HFPARNPEPNEENLKGFMEIV 231 + +D ++GA P + ELG +V+SV P+G + ENL+ + V Sbjct: 182 ----IALDCAHGAAYHIAPNVFHELGAEVISVGVDPNGLNINDGVGATRPENLR---QAV 234 Query: 232 KALGADFGVAQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLL 291 + GAD G+A DGD DR + +D G GDK ++A A E +V T+ ++ Sbjct: 235 LSHGADLGIALDGDGDRLIMVDRQGEIYDGDKLLYVIASARAAEGRLDGVVGTLMSNLGF 294 Query: 292 DDIAKRNGAKVMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVE 351 + +R G R KVGD V L E IGGE +G +I D DG ++ +++ Sbjct: 295 EHALERRGVAFARAKVGDRYVLEMLHERGWKIGGENSGHIICLDCHTTGDGIISALQVLA 354 Query: 352 IFAKSGKKFSELIDELPKYYQ--FKTKRHVEGDRKAIVAKVAELAEKKGYKIDTTDGTKI 409 SE +L Y Q + D KA A++A+ A D + Sbjct: 355 ALKHREMSLSEACKDLVFYPQRLINVRLPAGFDWKA-DARIAQTA---------ADAERT 404 Query: 410 IFDDGWVLVRASGTEPIIRIFSEAKSEE 437 + D G VL+R SGTEP++R+ E + E+ Sbjct: 405 LGDTGRVLLRPSGTEPLLRVMVEGRDEQ 432 Lambda K H 0.317 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 451 Length adjustment: 33 Effective length of query: 423 Effective length of database: 418 Effective search space: 176814 Effective search space used: 176814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory