Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_011765127.1 AZO_RS07050 triose-phosphate isomerase
Query= SwissProt::Q5SJR1 (250 letters) >NCBI__GCF_000061505.1:WP_011765127.1 Length = 242 Score = 208 bits (530), Expect = 7e-59 Identities = 119/249 (47%), Positives = 152/249 (61%), Gaps = 7/249 (2%) Query: 1 MRRVLVAGNWKMHKTPSEARVWFAELKRLLPPLQSEAAVLPAFPILPVAKEVLAETQVGY 60 M L+AGNWK++ + ++ EL+R + V +P L A+ ++A + + Sbjct: 1 MTTKLIAGNWKLNGSLAKNAALIDELRRA----EMHCVVCVPYPYLAQAQALVAGSLIEL 56 Query: 61 GAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGI 120 GAQDVS +++GAYTGEVSA ML + GCRY IVGHSERR G++D +V KA L G+ Sbjct: 57 GAQDVSEYEQGAYTGEVSAAMLVEFGCRYVIVGHSERRALFGDSDQVVGRKAASALAAGL 116 Query: 121 TPILCVGEPLEVREKGEAVPYTLRQLRGSLEGVEPPGPEALVIAYEPVWAIGTGKNATPE 180 TPI+CVGE L RE GE RQL+ + V LV+AYEPVWAIGTG++ATPE Sbjct: 117 TPIVCVGETLAERELGEVEAVIRRQLQAVADCVGGEALPTLVVAYEPVWAIGTGRSATPE 176 Query: 181 DAEAMHQAIRKALSERYGEAFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE 240 H IR S R AS VRILYGGSV P+N A L S +VDGGL+GGASL Sbjct: 177 QVAQTHGFIRAWFSAR---CDASAVRILYGGSVKPENAAVLFSTDDVDGGLIGGASLVGS 233 Query: 241 SFLALLRIA 249 F+A+ R A Sbjct: 234 DFVAICRAA 242 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 242 Length adjustment: 24 Effective length of query: 226 Effective length of database: 218 Effective search space: 49268 Effective search space used: 49268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_011765127.1 AZO_RS07050 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.8362.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-61 192.5 0.3 5.4e-61 192.3 0.3 1.0 1 lcl|NCBI__GCF_000061505.1:WP_011765127.1 AZO_RS07050 triose-phosphate iso Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000061505.1:WP_011765127.1 AZO_RS07050 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 192.3 0.3 5.4e-61 5.4e-61 1 225 [. 5 230 .. 5 233 .. 0.93 Alignments for each domain: == domain 1 score: 192.3 bits; conditional E-value: 5.4e-61 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGa 68 l+ +n+Kln+s+ k + ++ +l++ a+++ +v +p+ +l ++ v s i+++Aq+v ++Ga lcl|NCBI__GCF_000061505.1:WP_011765127.1 5 LIAGNWKLNGSLAKNAALIDELRR-----AEMHCVVCVPYPYLAQAQALVAgSLIELGAQDVSEYEQGA 68 689******************985.....678889999**********999999*************** PP TIGR00419 69 ftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleere....... 130 +tGe+sA+ml+++G+++v++gHsErR+l+ +d++++ k a + + gl+++vCvgetl+ere lcl|NCBI__GCF_000061505.1:WP_011765127.1 69 YTGEVSAAMLVEFGCRYVIVGHSERRALFGDSDQVVGRKAASALAAGLTPIVCVGETLAERElgeveav 137 **************************************************************7777777 PP TIGR00419 131 aartinnvattaaaaAlepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGa 199 r++++va+ + Al vvA+EPv++iGtG+++++ + + ++++r +++ a vr+lyG+ lcl|NCBI__GCF_000061505.1:WP_011765127.1 138 IRRQLQAVADCVGGEALPTLVVAYEPVWAIGTGRSATPEQVAQTHGFIRAWFSAR--CDASAVRILYGG 204 7778888888888888*********************************998653..33689******* PP TIGR00419 200 svtaaedaelaaqldvdGvLlasavl 225 sv+ +++a l+ dvdG L+++a+l lcl|NCBI__GCF_000061505.1:WP_011765127.1 205 SVKPENAAVLFSTDDVDGGLIGGASL 230 ************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.79 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory