Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_011765465.1 AZO_RS08775 NAD(P)-dependent oxidoreductase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_000061505.1:WP_011765465.1 Length = 288 Score = 97.1 bits (240), Expect = 4e-25 Identities = 76/252 (30%), Positives = 115/252 (45%), Gaps = 18/252 (7%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAG-----IADV 66 G ++ G +GIG A+A AF + A+V + + + E T R +L D+ Sbjct: 44 GKVAIITGGDSGIGRAVAIAFAKEGADVAVAYLEEHEDAEQTRREVELQGRRCLLMAGDI 103 Query: 67 SKQAQVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLR 126 ++ ++++ G LD++VNNA P E++ Q E T TNL S F R Sbjct: 104 GNESFTAKLVEQTLSAFGRLDIVVNNAAEQHPQENFEDISREQLERTFRTNLFSMFDLCR 163 Query: 127 KAVPVLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNA 186 A+P L++ A II +SV G Y++TK AIV +SLA L +RVNA Sbjct: 164 HALPHLQQG---ACIINTTSVTAYRGSAHLIDYSATKGAIVSFTRSLAQALAAKRIRVNA 220 Query: 187 ILPGVVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAG 246 + PG + + A E++ K L R D++A +FLAS Sbjct: 221 VAPGPIWTPLIPATFKAEE----------VEKFGAKEPLGRPGQPDEVAPSFVFLASQDA 270 Query: 247 SNVTGQAISVDG 258 S VTGQ + +G Sbjct: 271 SYVTGQVLHPNG 282 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 288 Length adjustment: 25 Effective length of query: 238 Effective length of database: 263 Effective search space: 62594 Effective search space used: 62594 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory