Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_011765660.1 AZO_RS09740 2,3-dehydroadipyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000061505.1:WP_011765660.1 Length = 264 Score = 142 bits (359), Expect = 5e-39 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 8/259 (3%) Query: 5 ILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQ 64 I++ + GV+ + L+RP+ N+ + + + L+Q E DD +RC++LTG + F AG Sbjct: 13 IVAGPDAGVLEIRLDRPQAKNALSTPLLRSIVALLEQAEHDDAVRCIVLTGGDQVFAAGA 72 Query: 65 DLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIV 124 DL + A D+ + L +A+ PKP+I AV G A G G L + DIV Sbjct: 73 DLAEM------AAKDMQAVLLEERPRLFGAIARFPKPIIAAVCGYALGGGCELVMHADIV 126 Query: 125 IAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIWQV 184 IA SA+F LG+IP GGT L R G++ AM L L G + A++A G++ +V Sbjct: 127 IAGESAQFGQPEINLGIIPGAGGTQRLTRAVGKSVAMKLVLAGEFIPAQEARAAGLVAEV 186 Query: 185 VDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLE-RDYQRLAGRSAD 243 V DE A +LA +A + + L K ++ A L L +E R++ LAG + D Sbjct: 187 VADEACIARAHELAGKIAKKAPLAVRLAKDSVLQAFETPLAAGLAIERRNFVVLAG-TED 245 Query: 244 YREGVSAFLAKRSPQFTGK 262 EGV +FL KR P + G+ Sbjct: 246 RNEGVKSFLEKRKPVWKGR 264 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 264 Length adjustment: 25 Effective length of query: 237 Effective length of database: 239 Effective search space: 56643 Effective search space used: 56643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory