Align Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_011765903.1 AZO_RS10980 acetyl-CoA C-acyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2411 (393 letters) >NCBI__GCF_000061505.1:WP_011765903.1 Length = 393 Score = 461 bits (1186), Expect = e-134 Identities = 236/393 (60%), Positives = 292/393 (74%) Query: 1 MNTPEIYVVSAARTAIGTFGGSLKDVPLADLATTAVKAALERAAVDPALVGHLVMGNVIP 60 M + E+ V+SA R+A+G FGGSLKD+ A+L VK A+ RA VDP V +GN IP Sbjct: 1 MASREVVVLSAVRSAVGGFGGSLKDMEPAELGGVVVKEAISRAGVDPKQVTFATVGNCIP 60 Query: 61 TETRDAYISRVAAMNAGIPKETPAYNVNRLCGSGLQAIINAAQTLMLGDADIVVGAGAES 120 TE+R Y++RVA + G+ E+ A+ VNRLCGS QAI+N+AQ ++LGDAD VG G E Sbjct: 61 TESRYPYVARVATIQGGMSMESVAFAVNRLCGSAQQAIVNSAQAILLGDADYAVGGGVEV 120 Query: 121 MSRGPYLMPAARWGSRMGNAQVIDYMLGILHDPFHGIHMGITAENVAARNGITREMQDAL 180 MSRG YLMPA R G+RMG+ + ID M+ +L DPF HMGITAEN+AA+ GI+RE QDA Sbjct: 121 MSRGAYLMPALRNGARMGDTKAIDAMVAVLTDPFGVGHMGITAENLAAKWGISREEQDAF 180 Query: 181 AFEDQQRAAHAIANGYFSEQIATVEIQDRKGVKLFSVDEHPRATSLEQLAAMKPAFKKDG 240 A E Q+RAA AIA+G F QI + + RKG +F DEHPRAT++E LA MKPAFKKDG Sbjct: 181 ALESQRRAAEAIADGRFKGQIVPITFETRKGPVVFDTDEHPRATTMEALAKMKPAFKKDG 240 Query: 241 SVTAGNASGLNDGAAALVMASGNAVQANNLKPLARLVSYAHAGVEPEFMGLGPIPATRLA 300 SVTAGNASG+ND AA LV+A A KP+ARLVSYA AGV + MG GPIP+++LA Sbjct: 241 SVTAGNASGINDAAAFLVLADAAKASAAGHKPMARLVSYAIAGVPNDLMGEGPIPSSKLA 300 Query: 301 LKRAGLTVADLDVIEANIAFAAQACAVSQELDLDPAKVNPNGSGIALGHPVGATGAIIAT 360 L+RAGLT+ +D+IE+N AFAAQ+ V++ L+LDPAK NPNG IALGHPVGATGA+I T Sbjct: 301 LQRAGLTLDKIDLIESNEAFAAQSLTVAKGLELDPAKTNPNGGAIALGHPVGATGAVIIT 360 Query: 361 KAIHELHRTGGRYALVTMCIGGGQGIAAIFERV 393 K +HEL RTGGRY + TMCIGGGQGI I+ER+ Sbjct: 361 KLLHELQRTGGRYGMATMCIGGGQGITTIWERI 393 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory