Align Ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_011765918.1 AZO_RS11055 ornithine carbamoyltransferase
Query= reanno::HerbieS:HSERO_RS07185 (304 letters) >NCBI__GCF_000061505.1:WP_011765918.1 Length = 311 Score = 454 bits (1168), Expect = e-132 Identities = 219/300 (73%), Positives = 253/300 (84%), Gaps = 1/300 (0%) Query: 4 KHYLQFSDFTLDEYEYVIERSRVIKRKFKNYEPHHTLADRTLVMVFEKNSTRTRLSFEAG 63 +HYLQFSDFT EY++V +R+R IK KFK YEP+H L DRTLVM+FEK STRTRLSFEAG Sbjct: 5 RHYLQFSDFTAAEYDHVFQRTRWIKEKFKQYEPYHPLFDRTLVMIFEKASTRTRLSFEAG 64 Query: 64 MHQMGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDVIMIRTYGQEIIERFAKHSRVPVI 123 M Q+GG+AIYLNTRDSQLGRGEPVEDAAQV+SRM D++MIRT+ Q+IIERFA +SRVPVI Sbjct: 65 MQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQDIIERFAAYSRVPVI 124 Query: 124 NGLTNEQHPCQVLADVFTYIEHHGSIQGKIVAWVGDANNMLYSWLQAAEVFGFHVNVSTP 183 NGLTNE HPCQ+LAD++T+IEH GSI+GK VAWVGD+NNM +WLQAAEV F V VSTP Sbjct: 125 NGLTNEYHPCQILADIYTFIEHRGSIKGKTVAWVGDSNNMCNTWLQAAEVLDFKVRVSTP 184 Query: 184 KGYDIDPAQVS-PGNKNYTFFADPADACQDADLVTTDVWTSMGFEAENNARLKAFDGWIV 242 GY+++P G ++ F+DP +AC+ ADLVTTDVWTSMGFEAEN AR+KAF W V Sbjct: 185 PGYEVEPTDAGLRGTAHFAQFSDPLEACRGADLVTTDVWTSMGFEAENEARMKAFADWCV 244 Query: 243 DQAKMARAKKDALFMHCLPAHRGEEVAAEVIDGPQSVVWEEAENRLHVQKALLEYLVHGR 302 D M+ A DALFMHCLPAHRGEEV AEVIDGPQSVVW+EAENRLHVQKAL+EYLV GR Sbjct: 245 DAEMMSVAAPDALFMHCLPAHRGEEVTAEVIDGPQSVVWDEAENRLHVQKALMEYLVLGR 304 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 311 Length adjustment: 27 Effective length of query: 277 Effective length of database: 284 Effective search space: 78668 Effective search space used: 78668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_011765918.1 AZO_RS11055 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.19999.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-111 356.3 0.0 8.2e-111 356.0 0.0 1.1 1 lcl|NCBI__GCF_000061505.1:WP_011765918.1 AZO_RS11055 ornithine carbamoylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000061505.1:WP_011765918.1 AZO_RS11055 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.0 0.0 8.2e-111 8.2e-111 1 303 [. 5 301 .. 5 302 .. 0.97 Alignments for each domain: == domain 1 score: 356.0 bits; conditional E-value: 8.2e-111 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 rh+l++ d++ +e ++ ++++ +k++ k+ + + l +tl +iFek+stRtR+sfe+++ +lG+ ++ lcl|NCBI__GCF_000061505.1:WP_011765918.1 5 RHYLQFSDFTAAEYDHVFQRTRWIKEKFKQYEPYHPLFDRTLVMIFEKASTRTRLSFEAGMQQLGGSAI 73 79****************************999************************************ PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 yln+ ++qlgr+e+++D a+v+sr+ d +++R+++++++e +a y+ vPvingLt++ hPcqilaD+ t lcl|NCBI__GCF_000061505.1:WP_011765918.1 74 YLNTRDSQLGRGEPVEDAAQVISRMSDLVMIRTFEQDIIERFAAYSRVPVINGLTNEYHPCQILADIYT 142 ********************************************************************* PP TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207 +e+ g++k+ ++++vGD+nn++n+ l aa l ++v+v+tP+g+e e++ a + +++ lcl|NCBI__GCF_000061505.1:WP_011765918.1 143 FIEHRGSIKGKTVAWVGDSNNMCNTWLQAAEVLDFKVRVSTPPGYEVEPTD---A---GLRGTAHFAQF 205 **********************************************98753...2...33566899999 PP TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276 +dp +a ++ad++ tDvw+smG e+++e+r+k++ ++ v+ e++++a p++ f+hCLPa+rGeevt ev lcl|NCBI__GCF_000061505.1:WP_011765918.1 206 SDPLEACRGADLVTTDVWTSMGFEAENEARMKAFADWCVDAEMMSVAAPDALFMHCLPAHRGEEVTAEV 274 ********************************************************************* PP TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303 ++g++s+v+deaenRlh+qka++++l+ lcl|NCBI__GCF_000061505.1:WP_011765918.1 275 IDGPQSVVWDEAENRLHVQKALMEYLV 301 ***********************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (311 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.63 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory