Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_011766230.1 AZO_RS12615 metal-dependent hydrolase
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_000061505.1:WP_011766230.1 Length = 597 Score = 227 bits (578), Expect = 5e-64 Identities = 117/250 (46%), Positives = 172/250 (68%), Gaps = 2/250 (0%) Query: 3 QTLLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTF 62 + +L+ ++V+++FGGL A N + + ++ G+I LIGPNGAGK+T FN I+G+ P +G Sbjct: 347 ELILEAKNVTRKFGGLIANNNMSLEVKAGEILALIGPNGAGKSTMFNQISGVDTPTSGEV 406 Query: 63 ELDGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKA 122 GKP + E+A+ G++R+FQ+++L M+VLENV +G H+R + V A +R Sbjct: 407 LFRGKPVAGHDSREIARMGMSRSFQHVKLLPTMSVLENVAIGGHLRGDKGVLSAAWRMD- 465 Query: 123 AREEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAA 182 REEEA + ++ + ++ VG+ + A L+ G QR LEIARAL +DP LL LDEPAA Sbjct: 466 -REEEARLLAEAARQIERVGLAEHMFDEAGSLALGQQRILEIARALCSDPCLLLLDEPAA 524 Query: 183 GMNATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQK 242 G+ EK L ELL K++AEG ILL+EHD+ +MGL +R+ V+++G+ IAEG+P DVQK Sbjct: 525 GLRFKEKEALGELLKKLKAEGMAILLVEHDMDFVMGLVDRVVVMEFGEKIAEGLPEDVQK 584 Query: 243 NPAVIEAYLG 252 NP V+EAYLG Sbjct: 585 NPKVLEAYLG 594 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 597 Length adjustment: 30 Effective length of query: 225 Effective length of database: 567 Effective search space: 127575 Effective search space used: 127575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory