Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_011766746.1 AZO_RS15175 aldehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_000061505.1:WP_011766746.1 Length = 486 Score = 312 bits (800), Expect = 1e-89 Identities = 183/455 (40%), Positives = 253/455 (55%), Gaps = 7/455 (1%) Query: 24 PATGDVLLEIAEASAEQVDAAVRAADAAF--AEWGQTTPKVRAECLLKLADVIEENGQVF 81 P +G VL E+A +SA VDAAV AA F EW + R L KLAD++ + + F Sbjct: 31 PTSGAVLAEVANSSAADVDAAVAAARVQFDGGEWSRLPGAERGRLLNKLADLLARDAERF 90 Query: 82 AELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGL---AAGEYLEGHTSMIRRDP 138 A + + G+PL ++P +D R+FAG A L G AG + R+ Sbjct: 91 AHILAMEQGRPLMEMRMLDLPMSIDTLRYFAGWADKLEGRQIPTAGFMGRPTLNYTIREA 150 Query: 139 LGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDI-FPAGVI 197 +GV A I PWN PLM+ WKLAPALAAG VVLKPSE PL LA LA + FPAGV Sbjct: 151 IGVAALIVPWNAPLMIGIWKLAPALAAGCTVVLKPSEDAPLALTALAGLAAEAGFPAGVF 210 Query: 198 NILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKAPVIVFD 257 N++ G G G L HP V +S TGS G I A KR +ELGGKAP I+ Sbjct: 211 NLVNGMGPEAGATLVKHPGVDKISFTGSTEVGRIIAREAAPLFKRLTLELGGKAPQIICA 270 Query: 258 DADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDEST 317 DA+++A + GV + N GQ C A RI + YD +V L A ++ G P D +T Sbjct: 271 DANLDAAIMGVAMGLFVNQGQTCAAGTRILVHRSRYDDVVGALAGAAKSVTLGDPLDANT 330 Query: 318 ELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRKGNGYYYAPTLLAGALQDDAIVQK 377 +G L + H +RV ++ A G ++ GGE NG++ PT+ AG I+++ Sbjct: 331 RMGALINARHRDRVAALIQSGIAEG-AALVAGGEALPENGFFVRPTVFAGGTPQMRIMRE 389 Query: 378 EVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTWVNTHFM 437 E+FGPV V PFD++E+ V AND+ +GL++S+WT+D+ RAH ++ +L+ G +N Sbjct: 390 EIFGPVGVVVPFDSDEEAVQLANDTPFGLSASLWTQDIARAHTLAPKLRVGAVAINGWSP 449 Query: 438 LVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMV 472 L + +P GG K SG G+D+S L+ YT + V V Sbjct: 450 LDARLPWGGYKDSGVGRDLSRTALDAYTEEKVVSV 484 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 486 Length adjustment: 34 Effective length of query: 440 Effective length of database: 452 Effective search space: 198880 Effective search space used: 198880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory