Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate WP_011767086.1 AZO_RS16880 NAD(P)-dependent oxidoreductase
Query= SwissProt::P28811 (298 letters) >NCBI__GCF_000061505.1:WP_011767086.1 Length = 293 Score = 172 bits (436), Expect = 8e-48 Identities = 99/271 (36%), Positives = 147/271 (54%), Gaps = 7/271 (2%) Query: 3 DIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVI 62 ++ F+GLG MG PM NLLKAGH V+V+ + ++++ L+E GA SA + A V Sbjct: 2 EVGFIGLGLMGRPMVLNLLKAGHTVHVWSRRRESMVPLLEAGAGDCASAAEVASRAAVTF 61 Query: 63 SMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVS 122 SM+ VE + LG+ G+ + + +D STIAP A+ +A A +G+TLLDAPVS Sbjct: 62 SMVADAPDVEQVTLGEGGVASAARAGHIHVDMSTIAPAAAQAIAARLAERGVTLLDAPVS 121 Query: 123 GGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILM 182 GG GA AGTL+ +VGG A F +P E MG++I GD GAGQVAK CN +L G+ + Sbjct: 122 GGEVGAIAGTLTIMVGGDAAAFDTVKPAFEAMGKSINRIGDSGAGQVAKACNQILTGVGV 181 Query: 183 AGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQVR 242 A AEAL ++G+D + E + + L + Q + GF+ Sbjct: 182 AAVAEALNFATRSGVDATKVREALLGGFAYSRILENHG-------QRMLDRNFRPGFKAW 234 Query: 243 LMNKDLGLALANAQAVQASTPLGALARNLFS 273 + KD+ + + A + + P A +F+ Sbjct: 235 MHQKDMRIVMEEAHRLGLALPSSAATAQMFN 265 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 293 Length adjustment: 26 Effective length of query: 272 Effective length of database: 267 Effective search space: 72624 Effective search space used: 72624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory