Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_011767184.1 AZO_RS17390 aspartate carbamoyltransferase
Query= curated2:Q7V8G9 (318 letters) >NCBI__GCF_000061505.1:WP_011767184.1 Length = 319 Score = 74.3 bits (181), Expect = 4e-18 Identities = 85/274 (31%), Positives = 124/274 (45%), Gaps = 23/274 (8%) Query: 51 GNRVLGLIFTKASTRTRVSFQVAMARLGGQTVDLNPQVTQLGRGEPLEDTARVLSRF-CD 109 G V L F STRTR +F++A RL V+LN + +GE L DT LS D Sbjct: 52 GKSVFNLFFEN-STRTRTTFEIAAKRLSADVVNLNIATSSSNKGESLLDTVDNLSAMQAD 110 Query: 110 VMAVRTFAQ-------QELLDYAHWASIPVLNALTDLE-HPCQAMADFLTIQEALGSLTG 161 + VR A Q LL I V+NA HP Q + D TI+ G T Sbjct: 111 MFVVRHAASGAPFLIAQHLLATGR-DHIRVVNAGDGRHAHPTQGLLDMYTIRHYKGDFTN 169 Query: 162 QTLAYVGD--GNNVSHSLMLCGALLGV-NVRIGCPQGFEPLPEVIDQARNLAVADARIEV 218 +A VGD + V+ S + LGV VR+ P+ LP +++ D R E Sbjct: 170 LVVAIVGDVLHSRVARSQIAALTTLGVPEVRVIGPKTL--LPTEVERMGVRVFHDMR-EG 226 Query: 219 MTDPVDAVRGAQALYTDVWASMGQEQEQSQREEAFRGFCLNEDLLAHADPNAIVLHCLPA 278 + D VD V + + ++ +E ++ + L + LA A P+AIV+H P Sbjct: 227 LKD-VDVVMMLRLQNERMNGAL-----LPTPQEYYKIWGLTAEKLALAKPDAIVMHPGPM 280 Query: 279 HRGEEISSGVMEGEASRIFDQAENRLHVQQALLA 312 +RG EI S V +G + I Q + V+ A+++ Sbjct: 281 NRGVEIDSAVADGTQAVILPQVTFGIAVRMAVMS 314 Lambda K H 0.321 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 319 Length adjustment: 27 Effective length of query: 291 Effective length of database: 292 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory