Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011767456.1 AZO_RS18735 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000061505.1:WP_011767456.1 Length = 244 Score = 241 bits (614), Expect = 1e-68 Identities = 128/234 (54%), Positives = 169/234 (72%), Gaps = 2/234 (0%) Query: 10 PLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVV 69 PLLQV G++ YG I+A+ G+D + GE+V LIGANGAGK+T + I G G ++ Sbjct: 8 PLLQVQGLQIAYGGIQAVKGIDFELYAGELVCLIGANGAGKTTTLNAIAGVLPTTGGDIL 67 Query: 70 FEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAE-DVEKIFT 128 + G I +P H+ R IA PEGR IF R+TV ENL+MGA + E D+EK++ Sbjct: 68 YAGERINPVPAHKRLRRGIALVPEGRGIFTRLTVEENLRMGAYTRRDRDGIEADLEKVYA 127 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 + PR+KER Q GTLSGGEQQM++IGRAL++RP+LLLLDEPS+GLAPL+V+ IFE ++ Sbjct: 128 MLPRVKERLPQVAGTLSGGEQQMVAIGRALLSRPRLLLLDEPSMGLAPLVVEKIFEVVQS 187 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 + + EG+T+ LVEQNA AL + R YVM +GKVT++GSG ELLANP+VRAAYL Sbjct: 188 VAK-EGVTILLVEQNANLALEFAQRGYVMESGKVTLTGSGSELLANPKVRAAYL 240 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 244 Length adjustment: 24 Effective length of query: 223 Effective length of database: 220 Effective search space: 49060 Effective search space used: 49060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory