Align Dehydrocarnitine CoA-transferase and acetoacetate CoA-transferase, subunit A (characterized)
to candidate WP_011777850.1 MVAN_RS02865 3-oxoadipate CoA-transferase subunit A
Query= reanno::pseudo6_N2E2:Pf6N2E2_2111 (232 letters) >NCBI__GCF_000015305.1:WP_011777850.1 Length = 232 Score = 202 bits (513), Expect = 6e-57 Identities = 98/208 (47%), Positives = 140/208 (67%), Gaps = 2/208 (0%) Query: 12 EEALEGLKDGMTVIAGGFGLCGIPENLIAEIKRKGIRDLTVVSNNCGVDGFGLGVLLEDR 71 EEA+ G+ DG T++ GGFG+ G+P LI + +G +LT+VSNN G GL LL Sbjct: 11 EEAVAGINDGATILVGGFGMAGMPTTLINALIEQGAAELTIVSNNAGNGDTGLAALLAAG 70 Query: 72 QIRKVVASYV--GENALFEQQLLSGEIEVVLTPQGTLAEKMRAGGAGIPAFFTATGVGTP 129 ++ KV+ S+ ++ +F+ +G++++ + PQG LAE++RA GAGI AFF TGVGTP Sbjct: 71 RVAKVICSFPRQADSYVFDALYRAGKVDLEVVPQGNLAERIRAAGAGIGAFFCPTGVGTP 130 Query: 130 VAEGKEVREFHGRQYLMEESITGDFAIVKGWKADHFGNVIYRHTAQNFNPLAATAGKITV 189 + EGKE R GR Y++E I GD A++ AD GN++YR TA+NF P+ ATA +TV Sbjct: 131 LVEGKETRTIDGRDYVLEYPIFGDVALIGAHVADQVGNLLYRKTARNFGPVMATAASLTV 190 Query: 190 VEVEEIVEPGELDPTQIHTPGIYVDRVI 217 VEV +V+ G++DP + TPGIYVDRV+ Sbjct: 191 VEVSRVVDTGQIDPETVVTPGIYVDRVL 218 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 232 Length adjustment: 23 Effective length of query: 209 Effective length of database: 209 Effective search space: 43681 Effective search space used: 43681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory