Align Acetate kinase; Acetokinase; EC 2.7.2.1 (characterized)
to candidate WP_011777976.1 MVAN_RS03540 acetate kinase
Query= SwissProt::P77845 (397 letters) >NCBI__GCF_000015305.1:WP_011777976.1 Length = 389 Score = 397 bits (1021), Expect = e-115 Identities = 199/387 (51%), Positives = 264/387 (68%), Gaps = 16/387 (4%) Query: 5 LVLNSGSSSIKFQLVNPENSAIDEPYVSGLVEQIGEPNGRIVLKIEGEKYTLETPIADHS 64 LVLNSGSSS+K+ ++ P++ + G+VE+IGE E + DH+ Sbjct: 6 LVLNSGSSSVKYAVLEPDSGVL---VADGIVERIGEEGA-------------ERAVTDHA 49 Query: 65 EGLNLAFDLMDQHNCGPSQLEITAVGHRVVHGGILFSAPELITDEIVEMIRDLIPLAPLH 124 + + FD + L + AVGHRVVHGG P ++ D + +++L PLAPLH Sbjct: 50 AAMQVVFDSLASDGHRLDDLGLVAVGHRVVHGGQDLYRPTVVDDATIARLKELSPLAPLH 109 Query: 125 NPANVDGIDVARKILPDVPHVAVFDTGFFHSLPPAAALYAINKDVAAEHGIRRYGFHGTS 184 NP + GI+VARK LPD+PHVAVFDT FFH LPPAAA YAI+ +VA IRRYGFHGTS Sbjct: 110 NPPAILGIEVARKALPDLPHVAVFDTAFFHDLPPAAATYAIDAEVAGSWHIRRYGFHGTS 169 Query: 185 HEFVSKRVVEILEKPTEDINTITFHLGNGASMAAVQGGRAVDTSMGMTPLAGLVMGTRSG 244 H++VS++ L P E ++ I HLGNGAS +A+ GGR V+TSMG+TP+ GLVMGTRSG Sbjct: 170 HQYVSEQAAAFLNVPLESLSQIVLHLGNGASASAILGGRPVETSMGLTPMEGLVMGTRSG 229 Query: 245 DIDPGIVFHLSRTAGMSIDEIDNLLNKKSGVKGLSGVNDFRELREMIDNNDQDAWSAYNI 304 D+DPG++F+L RTAGMS+++I+ +LN++SGV+GL G DFR L + I++ D A AY++ Sbjct: 230 DVDPGVIFYLWRTAGMSVEDIEAMLNRRSGVRGLGGEIDFRVLHQRIESGDAAAQLAYDV 289 Query: 305 YIHQLRRYLGSYMVALGRVDTIVFTAGVGENAQFVREDALAGLEMYGIEIDPERNALPND 364 YIH+LR+Y+G+Y+ LG VD I FTAGVGEN VR D L+GL +GIE+D NA P Sbjct: 290 YIHRLRKYVGAYLATLGSVDVITFTAGVGENDAAVRRDVLSGLTAFGIELDEHLNASPAR 349 Query: 365 GPRLISTDASKVKVFVIPTNEELAIAR 391 R IS D + + V V+PTNEELAIAR Sbjct: 350 TARRISPDGAPITVLVVPTNEELAIAR 376 Lambda K H 0.318 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 389 Length adjustment: 31 Effective length of query: 366 Effective length of database: 358 Effective search space: 131028 Effective search space used: 131028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011777976.1 MVAN_RS03540 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.10686.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-124 400.1 0.0 1.2e-123 398.7 0.0 1.5 1 lcl|NCBI__GCF_000015305.1:WP_011777976.1 MVAN_RS03540 acetate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_011777976.1 MVAN_RS03540 acetate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.7 0.0 1.2e-123 1.2e-123 3 401 .. 2 379 .. 1 382 [. 0.95 Alignments for each domain: == domain 1 score: 398.7 bits; conditional E-value: 1.2e-123 TIGR00016 3 skkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkl 71 s+ +lvln+Gsss+k+a+l+ s ++++g+veri e+a + a++dh++a++ + lcl|NCBI__GCF_000015305.1:WP_011777976.1 2 SRSVLVLNSGSSSVKYAVLEPD-SGVLVADGIVERIGEEGA--------------ERAVTDHAAAMQVV 55 5689****************99.57777*******998877..............457899******** PP TIGR00016 72 lntlkkdkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlkl 140 +++l +d + + + + ++GHRvvhGg+++ ++v+d +++++k++s+lAPlHnp+++ gie + lcl|NCBI__GCF_000015305.1:WP_011777976.1 56 FDSLASDGH-RLDDLGLVAVGHRVVHGGQDLYRPTVVDDATIARLKELSPLAPLHNPPAILGIEVAR-- 121 *****7554.4444467789**********************************************9.. PP TIGR00016 141 kvllkaknvavFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnl 209 k l++ ++vavFDtaf + +p a+ Ya+ ++ +RrYGfHGtsh+yv+++aa ln pl++l lcl|NCBI__GCF_000015305.1:WP_011777976.1 122 KALPDLPHVAVFDTAFFHDLPPAAATYAIDAEVAGSWHIRRYGFHGTSHQYVSEQAAAFLNVPLESLSQ 190 8899999************************************************************** PP TIGR00016 210 ivcHlGnGasvsavknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksG 278 iv+HlGnGas sa+ G+ ++tsmGltP+eGlvmGtRsGd+Dp++i+yl t g+s+++ie +ln++sG lcl|NCBI__GCF_000015305.1:WP_011777976.1 191 IVLHLGNGASASAILGGRPVETSMGLTPMEGLVMGTRSGDVDPGVIFYLWRTAGMSVEDIEAMLNRRSG 259 ********************************************************************* PP TIGR00016 279 llgisglssDlRdildkkeegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevre 347 + g+ g D+R++ +++e g+ a+lA++vy+hR++ky+g+y+a+l g++D i Ft+G+Gen+a vr+ lcl|NCBI__GCF_000015305.1:WP_011777976.1 260 VRGLGG-EIDFRVLHQRIESGDAAAQLAYDVYIHRLRKYVGAYLATL-GSVDVITFTAGVGENDAAVRR 326 ******.99**************************************.55******************* PP TIGR00016 348 lvleklevlGlkldlelnnaarsgkesvisteeskvkvlviptneelviaeDal 401 +vl++l +G++ld++ln + + + is + + ++vlv+ptneel+ia+ ++ lcl|NCBI__GCF_000015305.1:WP_011777976.1 327 DVLSGLTAFGIELDEHLNA-SPARTARRISPDGAPITVLVVPTNEELAIARACA 379 ******************9.88888999**********************9775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03 # Mc/sec: 4.04 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory