Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_011778076.1 MVAN_RS04045 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::P9WNP7 (286 letters) >NCBI__GCF_000015305.1:WP_011778076.1 Length = 284 Score = 433 bits (1114), Expect = e-126 Identities = 218/283 (77%), Positives = 248/283 (87%) Query: 4 AIQRVGVVGAGQMGSGIAEVSARAGVEVTVFEPAEALITAGRNRIVKSLERAVSAGKVTE 63 +I+RVGVVGAGQMGSGIAEV+A+AG V V+EP+EAL+ AGR+RI SLERA + GK+ Sbjct: 2 SIERVGVVGAGQMGSGIAEVAAKAGANVVVYEPSEALVAAGRDRITASLERAKAKGKLAA 61 Query: 64 RERDRALGLLTFTTDLNDLSDRQLVIEAVVEDEAVKSEIFAELDRVVTDPDAVLASNTSS 123 + D + LTFTT+L DL+DRQLVIEA+VE+EAVK+++FAELD VVTDPDAVLASNTSS Sbjct: 62 DDFDATVARLTFTTNLGDLADRQLVIEAIVENEAVKAKVFAELDAVVTDPDAVLASNTSS 121 Query: 124 IPIMKVAAATKQPQRVLGLHFFNPVPVLPLVELVRTLVTDEAAAARTEEFASTVLGKQVV 183 IPIMK+AAATK P RVLGLHFFNPVPVLPLVELV TLVT + A AR E FA VLGK+VV Sbjct: 122 IPIMKIAAATKNPSRVLGLHFFNPVPVLPLVELVNTLVTSDDAIARVERFAGEVLGKKVV 181 Query: 184 RCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAVVAGLSHPMGPLRLSDLVGLDT 243 RC DRSGFVVNALLVPYLLSAIRM EAG ATVED+D AVVAGLSHPMGPLRLSDL+GLDT Sbjct: 182 RCGDRSGFVVNALLVPYLLSAIRMAEAGVATVEDIDTAVVAGLSHPMGPLRLSDLIGLDT 241 Query: 244 LKLIADKMFEEFKEPHYGPPPLLLRMVEAGQLGKKSGRGFYTY 286 +KLIAD M++E+K+PHY PPPLL RMVEAGQLGKKSG+GFYTY Sbjct: 242 MKLIADSMYDEYKDPHYAPPPLLQRMVEAGQLGKKSGKGFYTY 284 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 284 Length adjustment: 26 Effective length of query: 260 Effective length of database: 258 Effective search space: 67080 Effective search space used: 67080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory