Align 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (characterized)
to candidate WP_011778303.1 MVAN_RS05205 5-dehydro-4-deoxyglucarate dehydratase
Query= BRENDA::Q6FFQ1 (303 letters) >NCBI__GCF_000015305.1:WP_011778303.1 Length = 313 Score = 219 bits (559), Expect = 5e-62 Identities = 120/288 (41%), Positives = 170/288 (59%), Gaps = 5/288 (1%) Query: 14 LLSFPVTDFDQNGDFNAASYAKRLEWLAPYGASALFAAGGTGEFFSLTGDEYSDVIKTAV 73 +L FPVT +G + + A+ + G +F A GTGEF +L +E+ DV++TAV Sbjct: 12 VLFFPVTPMTPSGAVDLDALARHIARGVDAGPGGVFIACGTGEFHALEDNEFGDVVRTAV 71 Query: 74 DACKGSVPIIAGAGGPTRQAILQAQEAERLGAHGILLMPHYLTEASQEGLVEHVKQVCNA 133 D G VP+ AGAGG QA A AE GA G+LLMP YL E Q GLV++ + V + Sbjct: 72 DVVAGRVPVYAGAGGAVAQAKRFALAAEESGADGLLLMPPYLVEVPQAGLVDYTRAVADT 131 Query: 134 VNFGVIFYNRSVSKLNVDSLQQLVESCPNLIGFKDSSGQIDMMTEVVQTLGDRLS----Y 189 + VI YNR+ ++ +S + E PN+IGFKD +G D++ +VQ + + + Sbjct: 132 TDLPVIVYNRNNARFTEESAVAVAE-IPNVIGFKDGTGNFDLVARIVQAVKTNVDPDFLF 190 Query: 190 LGGLPTAEIFAAPYKALGSPVYSSAVFNFIPKTAMEFYNALRNDDFATTQRLIRDFFLPL 249 GLPTAE Y+A+G P+YSSA F F P A+ FYNAL + + + L+ FF+PL Sbjct: 191 FNGLPTAETTQLAYRAIGVPLYSSATFAFAPDLALAFYNALDSGNEQLAEALLNAFFIPL 250 Query: 250 IKIRNRKSGYAVSMVKAGAKIVGHDAGPVRPPLSDLTPQDYEDLAALI 297 +++R+ GYAVS+VKAG + G AGPVRPPL D +LAA++ Sbjct: 251 VRLRDTVPGYAVSLVKAGVTMEGIPAGPVRPPLVMPGTDDLTELAAIV 298 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 313 Length adjustment: 27 Effective length of query: 276 Effective length of database: 286 Effective search space: 78936 Effective search space used: 78936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory