Align low-specificity L-threonine aldolase (EC 4.1.2.48) (characterized)
to candidate WP_011778448.1 MVAN_RS05945 threonine aldolase
Query= BRENDA::O50584 (346 letters) >NCBI__GCF_000015305.1:WP_011778448.1 Length = 343 Score = 219 bits (557), Expect = 1e-61 Identities = 132/339 (38%), Positives = 187/339 (55%), Gaps = 5/339 (1%) Query: 5 SQQFASDNYSGICPEAWAAMEKANHGHERAYGDDQWTARAADHFRKLFETD-CEVFFAFN 63 S FASDN + P A+ N G +YGDD TA AA+ R FE+ +V FAF Sbjct: 6 SAAFASDNAAPAHPRVLEALHHVNQGPAPSYGDDPVTAEAAEALRTAFESPGADVLFAFT 65 Query: 64 GTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTARSEGGKLTPASIR 123 GTAAN +AL+S + +H + CS+ AHV DE G P S G++L S+ G ++P + Sbjct: 66 GTAANIIALASAVRPWHEIFCSDVAHVLVDEAGGPVRLS-GAQLTRLASDDGLISPDELE 124 Query: 124 EVALKRQDIHYPKPRVVTITQATEVGSVYRPDELKAISATCKELGLNLHMDGARFSNACA 183 R +H+ +PR+V+ITQ+TE G V+ + LGL +H+DGAR +NA A Sbjct: 125 RRVRGRSAVHHSQPRIVSITQSTENGRVWSATAVAQFVDRAHALGLLVHVDGARIANAVA 184 Query: 184 FLGCTPAELTWKAGIDVLCFGGTKNGMAVGEAILFFNRKLAEDFDYRCKQAGQLASKMRF 243 L +P E A D++ GGTKNG+ G+AIL + + KQ G LASK RF Sbjct: 185 ALSISPLEAIGDA--DIVSVGGTKNGLMFGDAILVRRPAHFDGIHFVQKQIGHLASKHRF 242 Query: 244 LSAPWVGLLEDGAWLRHAAHANHCAQLLSSLVADIPGVELMFPVEANGVFLQMSEPALEA 303 ++A + GL E G WLR+AAHAN A+ LS+ + + G++L P E+N VF+++ A Sbjct: 243 VAAQFAGLFEGGLWLRNAAHANAMARRLSTGLEAL-GLQLASPTESNEVFVKLDGEAHRR 301 Query: 304 LRNKGWRFYTFIGSGGARFMCSWDTEEARVRELAADIRA 342 L + G RF+CSW T E V + A +R+ Sbjct: 302 LAERYLVHQPDPGQPVVRFVCSWSTTETEVDDALAALRS 340 Lambda K H 0.321 0.133 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 343 Length adjustment: 29 Effective length of query: 317 Effective length of database: 314 Effective search space: 99538 Effective search space used: 99538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory