Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_011778672.1 MVAN_RS07120 alpha-ketoacid dehydrogenase subunit beta
Query= SwissProt::Q5SLR3 (324 letters) >NCBI__GCF_000015305.1:WP_011778672.1 Length = 325 Score = 245 bits (626), Expect = 9e-70 Identities = 136/315 (43%), Positives = 195/315 (61%), Gaps = 8/315 (2%) Query: 9 ALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAIVGAAL 68 A++ A+ + + DPRV+++GEDV + GG + V++GLL+++GPDRV DTPLSE VG + Sbjct: 8 AVHDAIADALRDDPRVLLMGEDVARYGGTYAVSKGLLEEFGPDRVRDTPLSELGFVGIGI 67 Query: 69 GMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGVRGGHH 128 G A GLRP+ EI ++ DQ+V+ A LR+ SGGQF+ PLVVRM +G G + Sbjct: 68 GAALGGLRPIVEIMTVNFSLLALDQIVNTAAALRHMSGGQFSVPLVVRMATGAGRQLAAQ 127 Query: 129 HSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKE--EVPE 186 HS S E + H G+KVVA +T DA G+L A++D DPV+ E +LY + + E+ Sbjct: 128 HSHSLEGWYAHIPGIKVVAPATVEDAYGMLSTALQDPDPVIMFEHVQLYNTSADVAELGA 187 Query: 187 EDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEA 246 +D I +AA+RR+G D++LI YG +P+VL AA +LA AG+ EV+DLR L P D E Sbjct: 188 QD----ISRAAIRRQGSDVSLITYGGSLPKVLDAADQLALAGIDCEVIDLRVLRPLDTET 243 Query: 247 VMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQ--D 304 + SV KT R V+V + R S +E++ I E L AP RV + P PYA+ + Sbjct: 244 FVGSVRKTHRAVIVDEGWRTGSLAAEISTQITEQAFFDLDAPVARVCSAEVPIPYARHLE 303 Query: 305 KLYLPTVTRILNAAK 319 + LP I+ AA+ Sbjct: 304 QAALPQRDTIVAAAQ 318 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 325 Length adjustment: 28 Effective length of query: 296 Effective length of database: 297 Effective search space: 87912 Effective search space used: 87912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory