Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate WP_011778825.1 MVAN_RS07905 aspartate aminotransferase family protein
Query= BRENDA::Q9I6J2 (456 letters) >NCBI__GCF_000015305.1:WP_011778825.1 Length = 461 Score = 279 bits (714), Expect = 1e-79 Identities = 155/424 (36%), Positives = 237/424 (55%), Gaps = 12/424 (2%) Query: 38 IITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHP 97 IIT+ EGV+IWDS G K +D ++GL+ V G+GR+EL +AA +Q +L F+ L+ A P Sbjct: 37 IITRGEGVHIWDSTGRKYIDGLSGLFVVQAGHGRKELAEAAAKQAEQLAFFPLW-SYATP 95 Query: 98 PVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYH 157 +ELA +A AP +N VFFT G EA ++ ++ + Y+ G+P K VI R YH Sbjct: 96 TAIELADRLAHYAPADLNRVFFTTGGGEAVESAWKLAKQYYKLVGKPGKFKVISRAIAYH 155 Query: 158 GSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGG--DMSPDEFGVWAAEQLEKKI 215 G+ +++ G+ + + PG + +Y D P +G + A+++ + I Sbjct: 156 GTPQGALAITGLPDFKKPFEPLTPGGFRVPNTNFYRAPAPYDTDPKAWGRYCADRIAEAI 215 Query: 216 LEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWF 275 G + V A EP+Q AGG PP Y+ ++REI +YD+L ++DEVIC FGR G F Sbjct: 216 EFEGPDTVCAVFLEPVQNAGGCFPPPPGYFERVREICDEYDVLLVSDEVICAFGRIGSMF 275 Query: 276 GSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGE-FYHGFTYSGHPVAAAV 334 +G PD++ AKGLTSGY P+G ++ D + E N G F HG+T+ GHPV++AV Sbjct: 276 ACDDFGYVPDIITCAKGLTSGYSPIGAMIASDRLFEPFNDGKTVFGHGYTFGGHPVSSAV 335 Query: 335 ALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRE 394 AL N+ I E + VK + AP + ++L + P+VG+ RG G +ELVK+K T+E Sbjct: 336 ALANLDIFEREGLNAHVK-DNAPVFRATLEQLLELPIVGDVRGEGFFYGIELVKDKATKE 394 Query: 395 RFTDKGVGMLCR----EHCFRNGLIMRA--VGDTMI-ISPPLVIDPSQIDELITLARKCL 447 F + L R F GL RA GD ++ ++PPL+ + D + + + L Sbjct: 395 TFNEDESERLLRGFLTSALFEGGLYCRADDRGDPVVQLAPPLISGKKEFDAIYDILHRVL 454 Query: 448 DQTA 451 + + Sbjct: 455 SEAS 458 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 461 Length adjustment: 33 Effective length of query: 423 Effective length of database: 428 Effective search space: 181044 Effective search space used: 181044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory