Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_011779208.1 MVAN_RS09925 NAD(P)-dependent oxidoreductase
Query= metacyc::MONOMER-16231 (254 letters) >NCBI__GCF_000015305.1:WP_011779208.1 Length = 272 Score = 143 bits (360), Expect = 4e-39 Identities = 97/271 (35%), Positives = 142/271 (52%), Gaps = 26/271 (9%) Query: 1 MKLLEGKTVLVTGASTGIGRAAAIGAAQHGADV-AINYAHSDGPAQSCV----------A 49 M LEG+ +TGA+ G GRA A+ A GAD+ A++ A GP CV A Sbjct: 1 MSRLEGRVAFITGAARGQGRAHAVRMATEGADIIAVDIA---GPLPPCVPYDHATPDDLA 57 Query: 50 E----IEALGQRAIAVKGDVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPV 105 E +EA G+R +A K D D + + V K V G++DV+V+NAGI A+ D+ Sbjct: 58 ETVKLVEATGRRILASKVDTRDGEALRATVEKGVAELGRLDVIVANAGITAPQAWDDIGA 117 Query: 106 DVVERTFKVNLHGAYFMVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVH 165 D VN+ G + V A A +++ G GGSI+ +SS + + + HYT +K V Sbjct: 118 DDFRDVMDVNVTGTWNTVMAGAHKIIDGGRGGSIILISSAAGIKLQPFMIHYTASKHAVT 177 Query: 166 SLMQSTAIALGKHGIRCNSVLPGTILTEINKDDL------ADQEKREYMEARTPLGRLGA 219 + ++ A LGKH IR NSV PG +LT++ D+ A + + TP A Sbjct: 178 GMARAFAAELGKHSIRVNSVHPGPVLTDMGTGDMVTALGKAMETNPQLSNMMTPFLPTWA 237 Query: 220 --PEDLAGPIVFLASDMAAYVTGAALLVDGG 248 PED+A + +LASD + +VT +A+ VD G Sbjct: 238 VEPEDIADAVCWLASDESKFVTASAISVDQG 268 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 272 Length adjustment: 25 Effective length of query: 229 Effective length of database: 247 Effective search space: 56563 Effective search space used: 56563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory