Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_011779357.1 MVAN_RS10670 phosphoglycerate dehydrogenase
Query= BRENDA::Q9I530 (329 letters) >NCBI__GCF_000015305.1:WP_011779357.1 Length = 528 Score = 153 bits (386), Expect = 1e-41 Identities = 93/240 (38%), Positives = 132/240 (55%), Gaps = 15/240 (6%) Query: 65 AAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAY 124 AA ++VA G ++VD+ AA A G+ VV+ P + H+ AEHA+ L+L R++ A Sbjct: 62 AAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAAARQIPAAD 121 Query: 125 NRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPY-PNPRIQA 183 RE + +G ++ GK VGV+G G+IG+ A+ +A FG + AYDPY + R Sbjct: 122 ATLREHSWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRLAAFGAHITAYDPYVSHARAAQ 181 Query: 184 LGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAAL 243 LG L LD LL +D +S+H P T +T LI + LA KPG +++N RG L++ AAL Sbjct: 182 LGIELLTLDELLGRADFISVHLPKTKETAGLIGKEALAKTKPGVIIVNAARGGLIDEAAL 241 Query: 244 IEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREA 303 +A+ SG + GLDV+ S +P D L L P VVVT H T EA Sbjct: 242 ADAINSGHVRGAGLDVF-----------STEPCTDSPLFEL---PQVVVTPHLGASTVEA 287 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 528 Length adjustment: 31 Effective length of query: 298 Effective length of database: 497 Effective search space: 148106 Effective search space used: 148106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory